Scaffold Ga0101938_1001102

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0101938_1001102

Scaffold Ga0101938_1001102

Overview

Basic Information
Taxon OID	3300006838 Open in IMG/M
Scaffold ID	Ga0101938_1001102 Open in IMG/M
Source Dataset Name	Combined Assembly of Gp0125106, Gp0125107, Gp0125108
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Shell Corporation
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	7446
Total Scaffold Genes	11 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	5 (45.45%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Sediment → Syntrophic Microbial Communities From An Anoxic Layer Of The Sediment Of River Tyne Near Scotswood, United Kingdom

Source Dataset Sampling Location
Location Name	UK (Newcastle upon Tyne)
Coordinates	Lat. (^o)	54.971158	Long. (^o)	-1.703654	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F087385	Metagenome	110	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0101938_100110210	F087385	AGGGGG	LILPGGVLLSQKVTLLVPSALEVLTSVFGMGTGVAPPL*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.