NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0073934_10000652

Scaffold Ga0073934_10000652


Overview

Basic Information
Taxon OID3300006865 Open in IMG/M
Scaffold IDGa0073934_10000652 Open in IMG/M
Source Dataset NameHot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)96545
Total Scaffold Genes80 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)53 (66.25%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)

Source Dataset Sampling Location
Location NameCanada: British Columbia
CoordinatesLat. (o)60.1987Long. (o)-125.5127Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001231Metagenome / Metatranscriptome741Y
F065827Metagenome / Metatranscriptome127Y

Sequences

Protein IDFamilyRBSSequence
Ga0073934_1000065233F001231AGGAGGMVELRFRIRSNVFSAHSALRRSTIRPLALLCPSVEEAALLGEVDELGRLVPRKGVFYMSFLRTGPVIEGFEDCALGEFVRAQIEALSQNGEPPARCEVHGLDPFLELAEPQEAEKLRDLISVCEFRTNEFTPESAVRFLKESGFFDEYIIVGVKRGNGWRRSRCITTFEGRAADAATILGHLAEYFSKEQQDDKPHDDRRA*
Ga0073934_1000065237F065827N/AMITNLVRTCDMCHKEIPAGKYVQRNADRFGLEVLMVLAENEGRELQLIELPDGTIALDTCVECCSRMGFQHSQALN*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.