NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0098051_1087428

Scaffold Ga0098051_1087428


Overview

Basic Information
Taxon OID3300006924 Open in IMG/M
Scaffold IDGa0098051_1087428 Open in IMG/M
Source Dataset NameMarine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)841
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (80.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomonadales → Hyphomonadaceae → Henriciella → unclassified Henriciella → Henriciella sp.(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico

Source Dataset Sampling Location
Location NamePacific Ocean
CoordinatesLat. (o)-14.51Long. (o)-76.2Alt. (m)Depth (m)9
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F079927Metagenome115N
F105152Metagenome / Metatranscriptome100N

Sequences

Protein IDFamilyRBSSequence
Ga0098051_10874283F105152AGGAMNTHREWEQRIMSREYCRIDDCPSYDFSDYEDSKGYYTPYDDREVDYDPIDKVEMRERLKEVKQRRGITND*
Ga0098051_10874284F079927AGCAGGLVKRERGFKMSKDYREQSQLEDEADEKYLTMYQYYKELTDFERGEYDALHSYPFDESEEANKEYTEGYRTGYEYAQRMGAKDNE*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.