NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0102676_102167

Scaffold Ga0102676_102167


Overview

Basic Information
Taxon OID3300006999 Open in IMG/M
Scaffold IDGa0102676_102167 Open in IMG/M
Source Dataset NameNon-marine hypersaline water viral communities from A?ana, Logroño, Spain -Vir_A?ana_2_PRE
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Alicante
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1458
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Hypersaline Water → Non-Marine Hypersaline Water Viral Communities From Salinas De Anana, Spain

Source Dataset Sampling Location
Location NameAñana
CoordinatesLat. (o)42.80111387Long. (o)-2.985507Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F077438Metagenome / Metatranscriptome117Y

Sequences

Protein IDFamilyRBSSequence
Ga0102676_1021671F077438N/ARKSRFETLFLWSFHVEISIALRPKVEKETSSYNN*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.