Basic Information | |
---|---|
Taxon OID | 3300007185 Open in IMG/M |
Scaffold ID | Ga0099773_1133070 Open in IMG/M |
Source Dataset Name | Active sludge microbial communities from Klosterneuburg, Austria - Klosterneuburg WWTP active sludge MT KNB_T0_4L (Metagenome Metatranscriptome) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 591 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge → Active Sludge And Wastewater Microbial Communities From Klosterneuburg, Austria |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Austria: Klosterneuburg | |||||||
Coordinates | Lat. (o) | 48.3 | Long. (o) | 16.2 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F019117 | Metagenome / Metatranscriptome | 231 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0099773_11330701 | F019117 | N/A | MSVLAKVVLVLAIVAAVSAQKNKPKFSDSFTSNVEFVEVFNGQNFSIYGSWYVDFVGRQHAFHANDQTFGPMQIYRYYNLSKQYEFYVNSGFCNEQMGMRLPFFGTFDFLAKASNTGNCADRHGNNGLMWTATINSQPGFGFELNLCASATANIPYFIDMRGQWNYQDFERQV* |
⦗Top⦘ |