NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0104347_100997

Scaffold Ga0104347_100997


Overview

Basic Information
Taxon OID3300007271 Open in IMG/M
Scaffold IDGa0104347_100997 Open in IMG/M
Source Dataset NameMarine coastal surface water microbial communities in Port Hacking, Sydney, Australia ? TJ15 time point
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterAustralian Centre for Ecogenomics
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)29754
Total Scaffold Genes31 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)13 (41.94%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Marine Surface Water → Exploring Phylogenetic Diversity In Port Hacking Ocean In Sydney, Australia

Source Dataset Sampling Location
Location NamePort Hacking, Australia
CoordinatesLat. (o)-34.1192Long. (o)151.2267Alt. (m)Depth (m)1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F105107Metagenome100N

Sequences

Protein IDFamilyRBSSequence
Ga0104347_10099714F105107N/AMLQIQNTAIESFEGLLSYFEMIMLLSVLITLSIFKQANNIAILQSFGQSPLKISMIAACAPLILSFLFIGFSLLIPSNDVDTYPQWELEDQSISVLQKDKVISIDFSSNKINKVLSTTPNDLSANTEPSSVLQKMSSRTLSLPFATLALVLLASIFLFKHQRNFSISQSIFFGIAAGFGYKLISDLFYLGFRSFDLNINLGIYIPPTIALCFSVFFFLRLSKP*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.