Basic Information | |
---|---|
Taxon OID | 3300007885 Open in IMG/M |
Scaffold ID | Ga0111098_10394 Open in IMG/M |
Source Dataset Name | Spring water viral communities from Black Pool hot spring in the West Thumb Geyser Basin, Yellowstone National Park, WY, USA |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Roche Applied Science |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1484 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Alkaline → Planktonic → Spring Water Viral Communities From Black Pool Hot Spring In The West Thumb Geyser Basin, Yellowstone National Park, Wy, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Yellowstone National Park | |||||||
Coordinates | Lat. (o) | 44.41822 | Long. (o) | -110.57182 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F084271 | Metagenome / Metatranscriptome | 112 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0111098_103942 | F084271 | AGGA | MDRKGKADTVRVMGIKWIWNYKARKWEGGSTVGMWSLWYDGNRWQLQSPNGTIYTFLKQHRYEAMVQAGYTIASVERYLAGR* |
⦗Top⦘ |