Scaffold Ga0111098_10394

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0111098_10394

Scaffold Ga0111098_10394

Overview

Basic Information
Taxon OID	3300007885 Open in IMG/M
Scaffold ID	Ga0111098_10394 Open in IMG/M
Source Dataset Name	Spring water viral communities from Black Pool hot spring in the West Thumb Geyser Basin, Yellowstone National Park, WY, USA
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Roche Applied Science
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1484
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Alkaline → Planktonic → Spring Water Viral Communities From Black Pool Hot Spring In The West Thumb Geyser Basin, Yellowstone National Park, Wy, Usa

Source Dataset Sampling Location
Location Name	Yellowstone National Park
Coordinates	Lat. (^o)	44.41822	Long. (^o)	-110.57182	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F084271	Metagenome / Metatranscriptome	112	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0111098_103942	F084271	AGGA	MDRKGKADTVRVMGIKWIWNYKARKWEGGSTVGMWSLWYDGNRWQLQSPNGTIYTFLKQHRYEAMVQAGYTIASVERYLAGR*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.