 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Taxon OID | 3300007885 Open in IMG/M |
| Scaffold ID | Ga0111098_10489 Open in IMG/M |
| Source Dataset Name | Spring water viral communities from Black Pool hot spring in the West Thumb Geyser Basin, Yellowstone National Park, WY, USA |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Roche Applied Science |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1529 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → unclassified bacterial viruses → Cyanophage cp-OS | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Alkaline → Planktonic → Spring Water Viral Communities From Black Pool Hot Spring In The West Thumb Geyser Basin, Yellowstone National Park, Wy, Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Yellowstone National Park | |||||||
| Coordinates | Lat. (o) | 44.41822 | Long. (o) | -110.57182 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F069691 | Metagenome / Metatranscriptome | 123 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0111098_104892 | F069691 | AGG | MTGSPPSNLTVEQILAWALLALHTNGSSQTVQEGGETLPRFSYALAPNAIILRANLPLQQGWPGAASPLWTRVGEAVQGGLPTGF* |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |