NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0111098_11075

Scaffold Ga0111098_11075


Overview

Basic Information
Taxon OID3300007885 Open in IMG/M
Scaffold IDGa0111098_11075 Open in IMG/M
Source Dataset NameSpring water viral communities from Black Pool hot spring in the West Thumb Geyser Basin, Yellowstone National Park, WY, USA
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterRoche Applied Science
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1010
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Alkaline → Planktonic → Spring Water Viral Communities From Black Pool Hot Spring In The West Thumb Geyser Basin, Yellowstone National Park, Wy, Usa

Source Dataset Sampling Location
Location NameYellowstone National Park
CoordinatesLat. (o)44.41822Long. (o)-110.57182Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F040513Metagenome / Metatranscriptome161Y

Sequences

Protein IDFamilyRBSSequence
Ga0111098_110752F040513GAGVDALLTFLDFLVAELEYHYLLKRADSLCDYLDYLNAVISLNEIRASEEYRKLQ*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.