NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0111546_102269

Scaffold Ga0111546_102269


Overview

Basic Information
Taxon OID3300007907 Open in IMG/M
Scaffold IDGa0111546_102269 Open in IMG/M
Source Dataset NameMicrobial communities from sediment of the River Tyne Estuary, UK ? Pasteurized_176d_3
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Liverpool
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1889
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment → Anaerobic Oil Degrading Microbial Communities From River Tyne Estuarine Sediment

Source Dataset Sampling Location
Location NameUnited Kingdom
CoordinatesLat. (o)54.9632021Long. (o)-1.6348029Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F021528Metagenome / Metatranscriptome218N
F051104Metagenome / Metatranscriptome144Y

Sequences

Protein IDFamilyRBSSequence
Ga0111546_1022691F051104AGGAGLFELRIAEAIEEEAVLSQNLIEEGFNHAFKAGELLQEVKSMLSSEEELEQWLQENCSKVEKGVASSCLRLFNGETVKVEATLKREENHKR
Ga0111546_1022692F021528AGGAGMIDTLKLMLNEYQITDDSEIRVQPASYELGTGSKVEYPLFQTPSHGSFYGSKAYLNAENWNLTLKPLPGGRATGAFLQLSVPKNYYGSNFYSVGEQGTQAVLSKVEGELKEKGVHTPLIEADMSRVDTFKNIEPEEPFSSYYTLFSLLKARRAIQRGYGTTFLLSNSQQEFCVYDKLEEMRERNIETGGLPPTMRFEHRLLNKQKIQNVYGMSKVGELFKGGYEVVKEKQVESWKASLFNFTTEEFVLLGSKQLEQEMKKFKEKFPTGWFSRFLKAYGAYYLASHAGKEVVIEALKNAEAERTMIWRAVQIFEEAERELLVLKQEEGSKKTLGALYEELRRKVCLN*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.