Scaffold Ga0099820_1081808

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0099820_1081808

Scaffold Ga0099820_1081808

Overview

Basic Information
Taxon OID	3300008033 Open in IMG/M
Scaffold ID	Ga0099820_1081808 Open in IMG/M
Source Dataset Name	Coral microbial communities from Puerto Morelos, Mexico - Siderastrea T B metatranscriptome (Eukaryote Community Metatranscriptome)
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	657
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Invertebrates → Cnidaria → Coral → Unclassified → Coral → Coral Microbial Communities From Various Locations To Study Host-Microbial Communication

Source Dataset Sampling Location
Location Name	Mexico:El Islote,Puerto Morelos
Coordinates	Lat. (^o)	21.0853	Long. (^o)	-87.0617	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F093248	Metagenome / Metatranscriptome	106	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0099820_10818081	F093248	N/A	MLTCVVAKQAKTTTKVKNKFVNGKKVQKNTQLSFWWKAKSSI*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.