Basic Information | |
---|---|
Taxon OID | 3300008310 Open in IMG/M |
Scaffold ID | Ga0103551_100064 Open in IMG/M |
Source Dataset Name | Microbial communities from the gut of humanized mice in USA - PM96.FECAL.14dpc |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | CCME-COLORADO |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 2123 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → Microbial Communities From The Gut Of Humanized Mice In Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA | |||||||
Coordinates | Lat. (o) | 38.65 | Long. (o) | -90.26 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F047125 | Metagenome / Metatranscriptome | 150 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0103551_1000642 | F047125 | AGGA | MDVVLLLMVLGVMSSGFWAADALDHMRKEILQQEGKRRGWWS* |
⦗Top⦘ |