Basic Information | |
---|---|
Taxon OID | 3300008460 Open in IMG/M |
Scaffold ID | Ga0115203_116023 Open in IMG/M |
Source Dataset Name | Microbial communities of aphids from sagebrush in Onefour, Alberta, CA - Artemisaphis artemisicola CNC#HEM063374 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of Texas, Austin |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1236 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Host-Associated → Insecta → Unclassified → Unclassified → Unclassified → Sagebrush → Host-Associated Microbial Communities Of Aphids From Plants In Several Locations Around Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Onefour, Alberta, CA | |||||||
Coordinates | Lat. (o) | 49.115537 | Long. (o) | -110.468757 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F029983 | Metagenome | 186 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0115203_1160231 | F029983 | GAGG | MLLCCTVGYKWIHCLMDGITFEFNDIILCIKNDSVLRRFV |
⦗Top⦘ |