NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F029983

Metagenome Family F029983

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F029983
Family Type Metagenome
Number of Sequences 186
Average Sequence Length 40 residues
Representative Sequence MSLCCTVGYKWVTVMDGVKFEFNDIISLYKKNDSERKRSVSL
Number of Associated Samples 15
Number of Associated Scaffolds 186

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 57.30 %
% of genes near scaffold ends (potentially truncated) 82.26 %
% of genes from short scaffolds (< 2000 bps) 46.24 %
Associated GOLD sequencing projects 14
AlphaFold2 3D model prediction Yes
3D model pTM-score0.45

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (56.989 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Endosymbionts → Bacteria → Unclassified → Unclassified → Wheat
(79.032 % of family members)
Environment Ontology (ENVO) Unclassified
(99.462 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Animal → Animal corpus
(98.925 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 28.57%    β-sheet: 22.86%    Coil/Unstructured: 48.57%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.45
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 186 Family Scaffolds
PF00209SNF 0.54
PF00194Carb_anhydrase 0.54
PF05920Homeobox_KN 0.54
PF00004AAA 0.54
PF01251Ribosomal_S7e 0.54
PF00567TUDOR 0.54
PF00262Calreticulin 0.54
PF01294Ribosomal_L13e 0.54
PF14604SH3_9 0.54
PF05301Acetyltransf_16 0.54
PF01344Kelch_1 0.54

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 186 Family Scaffolds
COG0733Na+-dependent transporter, SNF familyGeneral function prediction only [R] 0.54
COG3338Carbonic anhydraseInorganic ion transport and metabolism [P] 0.54
COG4352Ribosomal protein L13ETranslation, ribosomal structure and biogenesis [J] 0.54


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms57.53 %
UnclassifiedrootN/A42.47 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300006021|Ga0058700_1010560All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis → Aphis craccivora639Open in IMG/M
3300008460|Ga0115203_109826Not Available1334Open in IMG/M
3300008460|Ga0115203_116023Not Available1236Open in IMG/M
3300008460|Ga0115203_135573Not Available1102Open in IMG/M
3300009454|Ga0127519_121564All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis → Aphis craccivora2369Open in IMG/M
3300009468|Ga0127530_104952Not Available1871Open in IMG/M
3300009468|Ga0127530_107241Not Available2168Open in IMG/M
3300009468|Ga0127530_141853All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha1236Open in IMG/M
3300009468|Ga0127530_145771Not Available1222Open in IMG/M
3300009468|Ga0127530_167013Not Available1373Open in IMG/M
3300009473|Ga0127520_1009776Not Available2415Open in IMG/M
3300009473|Ga0127520_1011186All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis2078Open in IMG/M
3300009473|Ga0127520_1028733All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Kalotermitidae → Cryptotermitinae → Cryptotermes → Cryptotermes secundus4336Open in IMG/M
3300009473|Ga0127520_1041464Not Available2796Open in IMG/M
3300009477|Ga0127522_109119Not Available4971Open in IMG/M
3300009477|Ga0127522_116554All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Macrosiphini → Diuraphis → Diuraphis noxia1665Open in IMG/M
3300009477|Ga0127522_131949All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis → Aphis craccivora1751Open in IMG/M
3300009478|Ga0127524_105073Not Available4210Open in IMG/M
3300009478|Ga0127524_125195Not Available3007Open in IMG/M
3300009478|Ga0127524_156725Not Available2419Open in IMG/M
3300009479|Ga0127529_1008064Not Available2576Open in IMG/M
3300009479|Ga0127529_1016164Not Available1024Open in IMG/M
3300009479|Ga0127529_1020501All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini2113Open in IMG/M
3300009479|Ga0127529_1050879Not Available2096Open in IMG/M
3300009479|Ga0127529_1055953All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Macrosiphini → Acyrthosiphon → Acyrthosiphon pisum4240Open in IMG/M
3300009479|Ga0127529_1067652All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis4661Open in IMG/M
3300009493|Ga0127654_153383Not Available2070Open in IMG/M
3300009493|Ga0127654_166991Not Available2268Open in IMG/M
3300009531|Ga0127525_120133All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae3571Open in IMG/M
3300009535|Ga0127526_1003942Not Available1771Open in IMG/M
3300009535|Ga0127526_1008954Not Available1069Open in IMG/M
3300009535|Ga0127526_1029689All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Macrosiphini → Acyrthosiphon → Acyrthosiphon pisum1305Open in IMG/M
3300009535|Ga0127526_1060880Not Available1465Open in IMG/M
3300009535|Ga0127526_1077605Not Available2844Open in IMG/M
3300009535|Ga0127526_1089232Not Available1001Open in IMG/M
3300009539|Ga0127521_114866Not Available1422Open in IMG/M
3300009539|Ga0127521_118266All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini3988Open in IMG/M
3300009539|Ga0127521_168310Not Available1479Open in IMG/M
3300010217|Ga0136159_1013496All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis → Aphis glycines2716Open in IMG/M
3300010217|Ga0136159_1035464All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis → Aphis craccivora1049Open in IMG/M
3300010217|Ga0136159_1046316Not Available785Open in IMG/M
3300010217|Ga0136159_1071848Not Available779Open in IMG/M
3300010225|Ga0136160_1002693Not Available1217Open in IMG/M
3300010225|Ga0136160_1002736All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae5782Open in IMG/M
3300010225|Ga0136160_1003169All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis → Aphis craccivora2243Open in IMG/M
3300010225|Ga0136160_1003925All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae3485Open in IMG/M
3300010225|Ga0136160_1004925Not Available2108Open in IMG/M
3300010225|Ga0136160_1005155All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae25847Open in IMG/M
3300010225|Ga0136160_1005570All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis → Aphis craccivora6259Open in IMG/M
3300010225|Ga0136160_1006194Not Available732Open in IMG/M
3300010225|Ga0136160_1006634All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae16376Open in IMG/M
3300010225|Ga0136160_1006801All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha4922Open in IMG/M
3300010225|Ga0136160_1007654Not Available5257Open in IMG/M
3300010225|Ga0136160_1008757All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Macrosiphini → Acyrthosiphon → Acyrthosiphon pisum7552Open in IMG/M
3300010225|Ga0136160_1009151All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota5811Open in IMG/M
3300010225|Ga0136160_1009270Not Available6561Open in IMG/M
3300010225|Ga0136160_1010286All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Phylloxeroidea → Phylloxeridae → Daktulosphaira → Daktulosphaira vitifoliae7667Open in IMG/M
3300010225|Ga0136160_1010674Not Available12469Open in IMG/M
3300010225|Ga0136160_1012207All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae7841Open in IMG/M
3300010225|Ga0136160_1013127Not Available2762Open in IMG/M
3300010225|Ga0136160_1013621Not Available3920Open in IMG/M
3300010225|Ga0136160_1014947Not Available3520Open in IMG/M
3300010225|Ga0136160_1015871Not Available6799Open in IMG/M
3300010225|Ga0136160_1016020All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis → Aphis craccivora565Open in IMG/M
3300010225|Ga0136160_1016213Not Available8175Open in IMG/M
3300010225|Ga0136160_1016558All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis → Aphis craccivora1820Open in IMG/M
3300010225|Ga0136160_1017326All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis → Aphis craccivora873Open in IMG/M
3300010225|Ga0136160_1017482Not Available18987Open in IMG/M
3300010225|Ga0136160_1018429All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota5670Open in IMG/M
3300010225|Ga0136160_1019005All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae15019Open in IMG/M
3300010225|Ga0136160_1020242Not Available6239Open in IMG/M
3300010225|Ga0136160_1020247All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis4450Open in IMG/M
3300010225|Ga0136160_1020403All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis → Aphis craccivora2837Open in IMG/M
3300010225|Ga0136160_1020522All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis → Aphis craccivora13682Open in IMG/M
3300010225|Ga0136160_1020620All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis → Aphis craccivora1808Open in IMG/M
3300010225|Ga0136160_1021392All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Macrosiphini → Acyrthosiphon → Acyrthosiphon pisum9666Open in IMG/M
3300010225|Ga0136160_1022083All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis → Aphis craccivora8537Open in IMG/M
3300010225|Ga0136160_1022280All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Macrosiphini → Acyrthosiphon → Acyrthosiphon pisum5564Open in IMG/M
3300010225|Ga0136160_1024876All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Macrosiphini → Acyrthosiphon → Acyrthosiphon pisum3008Open in IMG/M
3300010225|Ga0136160_1028554Not Available1185Open in IMG/M
3300010225|Ga0136160_1029270All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis → Aphis craccivora1877Open in IMG/M
3300010225|Ga0136160_1031704All Organisms → cellular organisms → Eukaryota → Opisthokonta5984Open in IMG/M
3300010225|Ga0136160_1031777All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae1614Open in IMG/M
3300010225|Ga0136160_1033260All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis → Aphis craccivora2610Open in IMG/M
3300010225|Ga0136160_1035161Not Available2622Open in IMG/M
3300010225|Ga0136160_1035503All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae3036Open in IMG/M
3300010225|Ga0136160_1035930All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis → Aphis craccivora4500Open in IMG/M
3300010225|Ga0136160_1037847All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Macrosiphini → Acyrthosiphon → Acyrthosiphon pisum4011Open in IMG/M
3300010225|Ga0136160_1038113All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Schizaphis → Schizaphis graminum4441Open in IMG/M
3300010225|Ga0136160_1038336All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Rhopalosiphum → Rhopalosiphum maidis1707Open in IMG/M
3300010225|Ga0136160_1038437All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae3768Open in IMG/M
3300010225|Ga0136160_1038478Not Available1525Open in IMG/M
3300010225|Ga0136160_1038510All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Macrosiphini → Diuraphis → Diuraphis noxia3261Open in IMG/M
3300010225|Ga0136160_1038562All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis → Aphis glycines2601Open in IMG/M
3300010225|Ga0136160_1039637All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis → Aphis craccivora3891Open in IMG/M
3300010225|Ga0136160_1040347All Organisms → cellular organisms → Eukaryota → Opisthokonta5677Open in IMG/M
3300010225|Ga0136160_1041326Not Available7087Open in IMG/M
3300010225|Ga0136160_1044836All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Macrosiphini7047Open in IMG/M
3300010225|Ga0136160_1044853Not Available5456Open in IMG/M
3300010225|Ga0136160_1052074Not Available6879Open in IMG/M
3300010225|Ga0136160_1053167All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Chaitophorinae → Sipha → Sipha flava2492Open in IMG/M
3300010225|Ga0136160_1053773All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis → Aphis craccivora3884Open in IMG/M
3300010225|Ga0136160_1054815Not Available1136Open in IMG/M
3300010225|Ga0136160_1055182All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha2337Open in IMG/M
3300010225|Ga0136160_1055248All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae2216Open in IMG/M
3300010225|Ga0136160_1056798Not Available923Open in IMG/M
3300010225|Ga0136160_1059841All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis → Aphis craccivora1212Open in IMG/M
3300010225|Ga0136160_1060201All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis → Aphis craccivora3098Open in IMG/M
3300010225|Ga0136160_1060785All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis → Aphis craccivora1666Open in IMG/M
3300010225|Ga0136160_1062546Not Available3347Open in IMG/M
3300010225|Ga0136160_1063684All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis → Aphis craccivora3134Open in IMG/M
3300010225|Ga0136160_1064360All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis → Aphis craccivora3709Open in IMG/M
3300010225|Ga0136160_1064508All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha5886Open in IMG/M
3300010225|Ga0136160_1065647All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis → Aphis craccivora799Open in IMG/M
3300010225|Ga0136160_1066027All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis → Aphis craccivora3174Open in IMG/M
3300010225|Ga0136160_1067375All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha3019Open in IMG/M
3300010225|Ga0136160_1067838All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis → Aphis craccivora1132Open in IMG/M
3300010225|Ga0136160_1068020Not Available1217Open in IMG/M
3300010225|Ga0136160_1070272Not Available1695Open in IMG/M
3300010225|Ga0136160_1072200Not Available763Open in IMG/M
3300010225|Ga0136160_1073050All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha4626Open in IMG/M
3300010225|Ga0136160_1073520All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis → Aphis craccivora2116Open in IMG/M
3300010225|Ga0136160_1075617All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis → Aphis craccivora2130Open in IMG/M
3300010225|Ga0136160_1076755All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Macrosiphini5070Open in IMG/M
3300010225|Ga0136160_1078694All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis → Aphis craccivora575Open in IMG/M
3300010225|Ga0136160_1080002Not Available1857Open in IMG/M
3300010225|Ga0136160_1081591Not Available1058Open in IMG/M
3300010225|Ga0136160_1081627All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis → Aphis craccivora1366Open in IMG/M
3300010225|Ga0136160_1082743All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis → Aphis craccivora2486Open in IMG/M
3300010225|Ga0136160_1084941All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis → Aphis craccivora647Open in IMG/M
3300010225|Ga0136160_1085931Not Available1412Open in IMG/M
3300010225|Ga0136160_1088569All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis → Aphis craccivora1557Open in IMG/M
3300010225|Ga0136160_1089650Not Available9851Open in IMG/M
3300010225|Ga0136160_1090099All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis → Aphis craccivora1039Open in IMG/M
3300010225|Ga0136160_1091615All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis → Aphis craccivora3750Open in IMG/M
3300010225|Ga0136160_1091941All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis → Aphis craccivora721Open in IMG/M
3300010225|Ga0136160_1092532All Organisms → cellular organisms → Eukaryota → Opisthokonta1152Open in IMG/M
3300010225|Ga0136160_1092798Not Available577Open in IMG/M
3300010225|Ga0136160_1093123All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae941Open in IMG/M
3300010225|Ga0136160_1093886Not Available799Open in IMG/M
3300010225|Ga0136160_1094829All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis → Aphis craccivora2610Open in IMG/M
3300010225|Ga0136160_1096343All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis → Aphis craccivora3558Open in IMG/M
3300010225|Ga0136160_1101271All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis → Aphis craccivora510Open in IMG/M
3300010225|Ga0136160_1103219Not Available639Open in IMG/M
3300010225|Ga0136160_1103894All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis → Aphis craccivora2389Open in IMG/M
3300010225|Ga0136160_1104504All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis → Aphis craccivora4615Open in IMG/M
3300010225|Ga0136160_1104640Not Available3026Open in IMG/M
3300010225|Ga0136160_1107447Not Available640Open in IMG/M
3300010225|Ga0136160_1108184Not Available2353Open in IMG/M
3300010225|Ga0136160_1109481Not Available1095Open in IMG/M
3300010225|Ga0136160_1111061Not Available628Open in IMG/M
3300010225|Ga0136160_1111341All Organisms → Viruses → Predicted Viral3265Open in IMG/M
3300010225|Ga0136160_1111902All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis → Aphis craccivora801Open in IMG/M
3300010225|Ga0136160_1112287All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis → Aphis craccivora1991Open in IMG/M
3300010225|Ga0136160_1117942All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis → Aphis craccivora2472Open in IMG/M
3300010225|Ga0136160_1122819Not Available983Open in IMG/M
3300010225|Ga0136160_1124260All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis → Aphis craccivora1398Open in IMG/M
3300010225|Ga0136160_1127247All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis → Aphis glycines735Open in IMG/M
3300010225|Ga0136160_1133703Not Available3975Open in IMG/M
3300010225|Ga0136160_1139741All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis → Aphis craccivora2946Open in IMG/M
3300010225|Ga0136160_1145066All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae764Open in IMG/M
3300010225|Ga0136160_1147844All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Macrosiphini → Acyrthosiphon → Acyrthosiphon pisum5752Open in IMG/M
3300010225|Ga0136160_1151362All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis → Aphis craccivora1509Open in IMG/M
3300010225|Ga0136160_1156512All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini591Open in IMG/M
3300010225|Ga0136160_1158422Not Available1170Open in IMG/M
3300010225|Ga0136160_1158803Not Available610Open in IMG/M
3300010225|Ga0136160_1160899Not Available577Open in IMG/M
3300010225|Ga0136160_1164972All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis → Aphis craccivora1971Open in IMG/M
3300010225|Ga0136160_1166435Not Available549Open in IMG/M
3300010225|Ga0136160_1170860All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis → Aphis craccivora3098Open in IMG/M
3300010225|Ga0136160_1176357Not Available732Open in IMG/M
3300010225|Ga0136160_1179625Not Available570Open in IMG/M
3300010225|Ga0136160_1179760All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis → Aphis craccivora1833Open in IMG/M
3300010225|Ga0136160_1181197Not Available1157Open in IMG/M
3300010225|Ga0136160_1182134All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae3832Open in IMG/M
3300010225|Ga0136160_1187027All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis → Aphis craccivora653Open in IMG/M
3300010225|Ga0136160_1187822Not Available506Open in IMG/M
3300010225|Ga0136160_1189221All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae833Open in IMG/M
3300010225|Ga0136160_1189604Not Available686Open in IMG/M
3300010225|Ga0136160_1193912Not Available1129Open in IMG/M
3300010225|Ga0136160_1198518All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis → Aphis craccivora778Open in IMG/M
3300010225|Ga0136160_1203450Not Available840Open in IMG/M
3300010225|Ga0136160_1204974All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis → Aphis craccivora862Open in IMG/M
3300010225|Ga0136160_1207261Not Available518Open in IMG/M
3300031996|Ga0308176_10658032All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis → Aphis craccivora1083Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
WheatHost-Associated → Endosymbionts → Bacteria → Unclassified → Unclassified → Wheat79.03%
Calyophus HartwegiiHost-Associated → Arthropoda → Aphids → Unclassified → Unclassified → Calyophus Hartwegii3.23%
WheatHost-Associated → Arthropoda → Aphids → Unclassified → Unclassified → Wheat3.23%
RosaHost-Associated → Arthropoda → Aphids → Unclassified → Unclassified → Rosa2.69%
SagebrushHost-Associated → Insecta → Unclassified → Unclassified → Unclassified → Sagebrush2.15%
LettuceHost-Associated → Insecta → Unclassified → Unclassified → Unclassified → Lettuce2.15%
Brassica OleraceaHost-Associated → Arthropoda → Aphids → Unclassified → Unclassified → Brassica Oleracea1.61%
Cirsium Sp.Host-Associated → Insecta → Unclassified → Unclassified → Unclassified → Cirsium Sp.1.61%
HoneysuckleHost-Associated → Insecta → Unclassified → Unclassified → Unclassified → Honeysuckle1.61%
Witch-HazelHost-Associated → Insecta → Unclassified → Unclassified → Unclassified → Witch-Hazel1.08%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.54%
CabbageHost-Associated → Arthropoda → Aphids → Unclassified → Unclassified → Cabbage0.54%
AgaveHost-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave0.54%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300006021Agave microbial communities from Guanajuato, Mexico - At.Am.eHost-AssociatedOpen in IMG/M
3300008460Microbial communities of aphids from sagebrush in Onefour, Alberta, CA - Artemisaphis artemisicola CNC#HEM063374Host-AssociatedOpen in IMG/M
3300009454Microbial communities of aphids from sagebrush in Onefour, Alberta, CA - Artemisaphis artemisicola CNC#HEM063374 seqcovHost-AssociatedOpen in IMG/M
3300009468Microbial communities of aphids from Rosa in Tucson, AZ, USA - Wahlgreniella nervata seqcovHost-AssociatedOpen in IMG/M
3300009473Microbial communities of aphids from lettuce in Tucson, AZ, USA - Acyrthosiphon lactucae NM052899 seqcovHost-AssociatedOpen in IMG/M
3300009477Microbial communities of aphids from Cirsium sp. in Ottawa, Ontario, CA - Brachycaudus cardui CNC#HEM061370 seqcovHost-AssociatedOpen in IMG/M
3300009478Microbial communities of aphids from honeysuckle in Ottawa, Ontario, CA - Hyadaphis tataricae CNC#HEM071793 seqcovHost-AssociatedOpen in IMG/M
3300009479Microbial communities of aphids from Triticum aestivum in Marana, AZ, USA - Sitobion avenae seqcovHost-AssociatedOpen in IMG/M
3300009493Microbial communities of aphids from witch-hazel in New Haven, CT, USA - Hormaphis hamamelidis NM061510_01 seqcovHost-AssociatedOpen in IMG/M
3300009531Microbial communities of aphids from cabbage in Tucson, AZ, USA - Lipaphis pseudobrassicae NM032704 seqcovHost-AssociatedOpen in IMG/M
3300009535Microbial communities of aphids from Calyophus hartwegii in Tucson, AZ, USA - Macrosiphum gaurae seqcovHost-AssociatedOpen in IMG/M
3300009539Microbial communities of aphids from Brassica oleracea in Tucson, AZ, USA - Brevicoryne brassicae seqcovHost-AssociatedOpen in IMG/M
3300010217Sitobion avenae (English Grain Aphid) hemolymph microbial communities from Henan Dengzhou, China ? Region2Host-AssociatedOpen in IMG/M
3300010225Sitobion avenae (English Grain Aphid) hemolymph microbial communities from Shanxi Taiyuan, China - Region1Host-AssociatedOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0058700_101056023300006021AgaveMSLCCTVGYKWVTVMDGVKFEFNDIISLYKKNDSERKRSVSL*
Ga0115203_10982613300008460SagebrushVGYKWGTLMDGVKFEFNDII*LYTKNVSERRPRFISLGYFILYLS*
Ga0115203_11602313300008460SagebrushMLLCCTVGYKWIHCLMDGITFEFNDIILCIKNDSVLRRFV
Ga0115203_13557313300008460SagebrushMTLCCTVDYKCVTVMDGVKFELNYIILLYTKNDA*
Ga0127519_12156413300009454SagebrushMSLCCTVDYKWVTVMDGIKYEFNDIILLHKNHMI*
Ga0127530_10495213300009468RosaMSLFCTVGYKVGQCITDCIKFELNDIISLYRKNDSE
Ga0127530_10724113300009468RosaMSIFCTVGYKWVTVMNGVKFELNDIISLNTKNDSERR
Ga0127530_14185313300009468RosaVSICCTIGYKWVTIIDVVKFEFNDKKSLYKKNASKRRLSV
Ga0127530_14577123300009468RosaVSLCCIVGYKLVTVMNGVQFEFNDKISLYKKNGSERR
Ga0127530_16701313300009468RosaVLXXCTVGYKRGTVMDGVIFKFNDIXSLYKKNDSERRQ
Ga0127520_100977613300009473LettuceMYKKVGKYMSLRCSVGYKLVTVMNGVKFEFNDIKSLYKKNDTERK
Ga0127520_101118613300009473LettuceMSLCCTVGYKWVTVMDGVRFEFNDIISSYTKNDSERRRLVS
Ga0127520_102873313300009473LettuceVAK*MSLCCTVDYKWVAVMDGVKFEFNNIVSLYKKNGQ
Ga0127520_104146413300009473LettuceMSLWCTIGYKWVFVMDCGKFEFNDKLLLYKKNDSERRRTTSL*
Ga0127522_10911923300009477Cirsium Sp.MSLCCTVGYKWVTVMDGIKFEFSYVKSFYMKNDSERRWSVSL*
Ga0127522_11655413300009477Cirsium Sp.MSLYTVGYKWVTVVCGVIFEFNEIKLLYTKYDSERRRSAYNIT*
Ga0127522_13194913300009477Cirsium Sp.MSLCCTVGYKWVTVMDDIKFEFIDIISLYTKNDSEWRRFVSQGYVILY*
Ga0127524_10507313300009478HoneysuckleMSLGCTTDCKRVTVMDGIKFEFNDIISLYTNNDFER
Ga0127524_12519513300009478HoneysuckleMTLCCTVGYK*ITVMDGIKFELNDIISLYTENDS*
Ga0127524_15672513300009478HoneysuckleMSLCCTVDYKRVTVMNGIKFEFNKIKPLYTHNDSERRRFVSLEYFN*
Ga0127529_100806413300009479WheatMSHCCTVGYKWVAIMDGFNFKSNDIISLYNKNDSERKQSV
Ga0127529_101616413300009479WheatVGXXXSLCCTVGYKEVTVMDGXXXEFDDIISLYKKND
Ga0127529_102050113300009479WheatMSLCSTVGFKWVTVMDGVKFQFNDIISLYKKNGQSAY
Ga0127529_105087913300009479WheatMSLCCTVGYKWVTVMDGVKFEFNDIIWLYKKNDSE
Ga0127529_105595313300009479WheatVSLXXTEVYKWDTVMDGVKXEFNDIILLYEKNNSERKRSV
Ga0127529_106765223300009479WheatMSLCCTVGDKLVTVMDGVKXEFNDIISXXXXXDSERKRTVSL*
Ga0127654_15338313300009493Witch-HazelMSLCCTVDYKWVAVMEGVKFEFNDISFYKKNDSER
Ga0127654_16699113300009493Witch-HazelVSLYCTVGYKWETVMDGVIKFEFNDIISLYKINDCERRRSV
Ga0127525_12013323300009531CabbageMSLCCTVAYEWITVMDVIKFEFNDIITLYMKNDSELSQLSV*
Ga0127526_100394213300009535Calyophus HartwegiiMSLYCTVGFKCRGCMDGVKFEFNNIIPLYKXNDSERKRS
Ga0127526_100895423300009535Calyophus HartwegiiVGKWMSLXCTVDYKWVTLMDGFTFEFNDIISLYKQ
Ga0127526_102968913300009535Calyophus HartwegiiLCCTVGYKWVTVMDCVKFEFNXXISLYTKNDSER*
Ga0127526_106088013300009535Calyophus HartwegiiMSLCCTVGYKWITDHCIMDCIRFEFNDIISLYRYTKNDSERRRFV
Ga0127526_107760513300009535Calyophus HartwegiiMSLCYTXXYKWVTVMDFVKFELKDIISLYKXNDSERKR
Ga0127526_108923213300009535Calyophus HartwegiiMSLCCTVGYKWVTVMDDVKFESNXXISLYTKKILSENG
Ga0127521_11486613300009539Brassica OleraceaMSLCCTVGYKLVTVMDGXXFEFNDLISSYTKNDSEWRRFV
Ga0127521_11826643300009539Brassica OleraceaMSLCCTVGYKWVNVLDGIIYFEFNDIISLYTKNDSXXXRFVSLGFFTLD*
Ga0127521_16831013300009539Brassica OleraceaMSLCCTVVYKWITVKDGIKFEFNDIINDSDRRRVLSLGYFI
Ga0136159_101349613300010217WheatVLFCCTVGYKWVIVMDDFKFEFNDIYNIVSLYKKNDS
Ga0136159_103546413300010217WheatVSLCCTIGYKWVTVMDCVQFEFNGIILLYKKNDFERRSASQPMILP
Ga0136159_104631613300010217WheatMQLCRTVDYKWVTVMGGITFEFNVIISLYPKNDSERRRF
Ga0136159_107184813300010217WheatVSLCCIEVYKWVAVMVGVKFEFNDIIPLHKKKRFW
Ga0136160_100269313300010225WheatMSLCCTVGHKRVTVMDGVKFEFNDIISLYKKDDSERKRS
Ga0136160_100273653300010225WheatMSLCCTVGYKWVSVFIMDFIKFELNDIISLYNKNDSERRWFV
Ga0136160_100316913300010225WheatMSLCCTVGHKWVTVMDGVKFEFNDIISLYKKNDSERK
Ga0136160_100392543300010225WheatMSLCCTVGYKWVTEMDGVKFEFNDIISLYKKNDSERKRSVSL*Y
Ga0136160_100492513300010225WheatMSLCCAVGYK*VTVMDGIKFKFNDIISLYKKTDPERKRPVSL*N
Ga0136160_100515593300010225WheatMPLCCTVGYKWVTVMDGVKFEFNDIISLYKKNDSERKRSVSL*
Ga0136160_100557013300010225WheatMSLCCTVGYKGVTVMDGVKFEFNDIISLYKKNGSERKR
Ga0136160_100619413300010225WheatMSLCCTVGDKWVTEMDGEFNDIILLLHKKNDSERKRSVSL*
Ga0136160_1006634133300010225WheatMSLCCTVGYKWATVMDGVKFEFNDIISLYKKNDSERKQ
Ga0136160_100680143300010225WheatMSICCTVGYKWVTVKDGVKFEFNDIISLYKKSDSERKRSVSL
Ga0136160_100765413300010225WheatMSLCCTVDYKWVTVMDSVKVEFNDIPDISLYKKNDSERKRS
Ga0136160_100875713300010225WheatMSLRCTVGYKLVNVMDGVKFEFNDIISLYKKNDSERKRSVSL*
Ga0136160_1009151103300010225WheatMSLYCTVGYKWVTVMDGVKFEFNDIISLYKKNDAE
Ga0136160_100927013300010225WheatMSLCCTVGDKWVTVKDGVKFEFNDIISLYKKNDSERKRSVNL*
Ga0136160_101028663300010225WheatMSLCCTVGYTWVTVMDGVKFEFNDIISLYQKNDSER
Ga0136160_101067413300010225WheatMSLCFTVGYKGVTVMDGVKFEFNDIISLYKKNGSERKR
Ga0136160_101220753300010225WheatMSLCCTVGDKWVTVINGVKFEFNDIISLYKKNDSERSR
Ga0136160_101312713300010225WheatMSLCCTVGYKWLTVMNGVKFEFNDIILLYKKNDYDRKRSVS
Ga0136160_101362113300010225WheatMSLC*TVGYKWVTVMDGVKFESNDIKSLYKKNDSER
Ga0136160_101494713300010225WheatMSLCCIVGHK*VTAMDGVKFESNGIISLYKKIDSER
Ga0136160_101587143300010225WheatMSLCCTVGYKWVTVMDGVKFEFNDIISLYKKNDSE
Ga0136160_101602013300010225WheatVDYKWVTVMDGVKFEFNDIISLYKKNDSERKLSVGL*
Ga0136160_101621343300010225WheatMSLCYTVGYKWFAVMDGVKFEFNDIISIYKKNDSERKRSVSL*
Ga0136160_101655823300010225WheatMSLCCTLGYKWVTVMDGVKFDINDIISLYKKTILT
Ga0136160_101732613300010225WheatMSLCCTVGYKWVTAIDGVKFEFNDIISLYKKNDSERKRSVRL*C
Ga0136160_101748273300010225WheatMSLCCTVGCKWVTAVMDGVKFEFNDIISLYKQNDSERNLSVR
Ga0136160_101842943300010225WheatMSLCCTVGYKWDTVMDGVTFEFNDIISLYKKNDSERRRLYNITKYI*
Ga0136160_101900513300010225WheatMDKWVSLCCTVGYKWVTVIDSVKLEFNDIISLYKKNDSERKRSVSL*
Ga0136160_102024213300010225WheatMSLCCTVGYRWVTVMDGVKFEFNDIISLYKKNDSERK
Ga0136160_102024733300010225WheatMSLCCTVGYKWIIVIYGVKFEFNDIISLYKKNGSE*KTVT
Ga0136160_102040313300010225WheatMSLCCTVGYKWVSVTDDVKFEFNDIISLYKKNDSKR
Ga0136160_102052253300010225WheatMSLCCRLGYKKVTAMDGVKFEFNDIISLYKIKDSERKRP
Ga0136160_102062013300010225WheatMSLCCTVGYKWVTVMNGVKFEFNDIISLYKKNDSERKRSVSL*YY
Ga0136160_102139243300010225WheatMSFCCTVDFKCVTEMYGFKFEFNDIISLYTKNDSERRRFISQGYFILKM*
Ga0136160_102208353300010225WheatMSLCCTVGYKWVTVMDSIKFEFNDIISLYKKNDSERKRLVSLLY
Ga0136160_102228013300010225WheatMSLCCTVGDKWVIVMDGVEFEFNDIIPLYKKNDSERKRSVSL*
Ga0136160_102487613300010225WheatCCTVSYMWLTVMNDVKFELNDIISLYKKNDSERRWPESLGYY*
Ga0136160_102855413300010225WheatVSLCCTVGYNWVTVMDGVKFEFNDIISLYKINDSEQKR
Ga0136160_102927013300010225WheatMSLCCTVGYKWDTVMDGVKFEFNDIISLYKKNDSERKRSVSL
Ga0136160_103170413300010225WheatMMKKVGKWMSLFCTVGYKWATVMDGVKFEFNDIISLYKKNDSERKQ
Ga0136160_103177713300010225WheatMSLCFIVGYKWVTVMDGVKFEFNDIISLYKKNDSERKRSVSL*YYQVYLMI
Ga0136160_103326023300010225WheatMSLCCTVGYKWVTVMDGVKFEFNNIILSLYKKNDSEQKRSVSL*YYQVYLM
Ga0136160_103516113300010225WheatMSLCCTVGDKCVTVMDGVKFEFNDIISLYKKNDSK*K
Ga0136160_103550313300010225WheatVGKGMSLCCTVGHKWVTVMDGVKFEFNDIISLYKKNDSERK
Ga0136160_103593013300010225WheatMSLCCTVGYKWVTVMDCVKFEFNDIISLYKKTDSERKR
Ga0136160_103784763300010225WheatVSLRCTEVYKWVTVMDGVKFEFNDIISLYKKNDSERK
Ga0136160_103811313300010225WheatMSLYYKVGYKWVTVMYGVKFEFNDIISLYKKNDSERKRSVSL*YY
Ga0136160_103833623300010225WheatMSLCCTVGYKWVTVMDGIRIEFNDIISLYKKNDFERKRSVSL*
Ga0136160_103843723300010225WheatMSLCCTVGYKWVTVMAGIKFEFNDISLYIKNNSER*
Ga0136160_103847813300010225WheatMSLYCIVGYKWVTVMDNVKFEFNDIISLYKKNDSERKQSVSL*YYKVY
Ga0136160_103851033300010225WheatMSLCCTVGYKWVAVMDGVEFEFNDIISLHTKNDSER*
Ga0136160_103856233300010225WheatMSLCCTVGYKRVTVMDGVKFEFYDIIYLHKKKDSERKR
Ga0136160_103963713300010225WheatMSLYCTVGYKWVTIMDGVKFEFNDIISLYKKNDSKRKRSVRL*
Ga0136160_104034743300010225WheatMSICCTVGYKWVTVMDGVKFEFNDIISLYKKNDSERKRSVSL
Ga0136160_104132633300010225WheatVGCIVGYKCVTVMDGVKFEFNDIISLYKKNGQSAYD
Ga0136160_104483613300010225WheatMGKWMSPCCTVGYKWVTVMDGVKFEFNDIISLYKKND
Ga0136160_104485343300010225WheatMPFCCTVGYKWVTVMDGVKFEFDDIISLYKKNDSE
Ga0136160_105207413300010225WheatMSLCCTVYDKWVYVMDGVKFEFNDKISLYKKTDSERKRLASLCYNQVYL*
Ga0136160_105316713300010225WheatMSLCCTVGYEWVTVMDGVKFEFNDIISLYKKNDSEQK
Ga0136160_105377313300010225WheatMSLCCTVIDGVKFEFNDIISLYKTNDSERKRSVNL*Y
Ga0136160_105481513300010225WheatMSLCCTVDDKWVTVMDGVKFEFNDIISSYKKNDSGRKR
Ga0136160_105518213300010225WheatMSLCCTVGYKWFTVMDGVKFEFNDIISLYKKNDSERKRSVRL
Ga0136160_105524823300010225WheatMSLYCTVGYKWVTIMDGVKFEFNDIISLYKKNDSERKRSVRL*
Ga0136160_105679813300010225WheatMGKCVLLCCTVDYK*VTVIDCVKFEFNDISLYKKNDS
Ga0136160_105984113300010225WheatMSLCCTVGYKWVTVMDGIKFKFNDIISLYKKTDPERKRPVSL*N
Ga0136160_106020113300010225WheatMSLYCTVGDKWVTVMDGVKFDFNDIISLYKKNDSERKRSVRL*
Ga0136160_106078513300010225WheatMSLCCTVGYKWVTVMDSVKVEFNDIPDISLYKKNDSERKRS
Ga0136160_106254623300010225WheatVSLYCTVGYKWVTVMDGVKFEFNDIISLYKKNDAE
Ga0136160_106368413300010225WheatMSLCYTVGYKWVTVMDGVKFELFDIISLYKKNDSERKRSVSL*
Ga0136160_106436013300010225WheatMLLCCSVGYKWVTIMDGVKFEFNDITSLGTKNASERRRFFSLDISYC
Ga0136160_106450813300010225WheatMSLCCTVGYKWVTVMDGVKFEFNDIISLYKKNDSAKT
Ga0136160_106564713300010225WheatMSLCFTVGYKWITVMDGVKFEFNDIISLYKKNDSERKRSVS
Ga0136160_106602713300010225WheatMSLCCTVGYKWVTLMDGVKFEFNDIISLYKKNDSERKRSVSL*
Ga0136160_106737513300010225WheatMSLCRMVGNKWVTVMDSVNFEFNDIISLYKKNDSERRRYVSLGKRT
Ga0136160_106783813300010225WheatMSLCCTVGYKWVTVIDGVKFEFNDIISFYKKNDSERKR
Ga0136160_106802013300010225WheatMSLCCTVGYK*VNVIDGVEFEFNDIKSLYKKNDSERRLSASL*
Ga0136160_107027213300010225WheatVGKWVSFCCTVGYKWVTVMYGVKLKLNDIISWYKKNDSGRKRSV
Ga0136160_107220023300010225WheatMSLCCKVGYNWVTVMDGVKFEFNDIIPLYKKNDSER
Ga0136160_107305053300010225WheatMSLCYAVGYKWVTVMDGVQFEFNDIISLYKKNDSE
Ga0136160_107352013300010225WheatVSLCCTVGYKWVSVKDGVKFKFNDLISLYTKNDSK
Ga0136160_107561713300010225WheatMLLCCTVGYKRVTVMDCVKFEFNDIISLYKKNDQSAY
Ga0136160_107675553300010225WheatMFLCFTVGYKWVIVMDGVKFEFNDIISLYTNNDSERRRFVSQGYLYCYF*
Ga0136160_107869413300010225WheatKVGKWMSLCCTVGYKWVTVMDGVKFEFNDIMSLYKKNDSERKRSVSL*
Ga0136160_108000213300010225WheatMSLCDTVGNKWVTVMDGVKFEFNDIISFYKKNESERKR
Ga0136160_108159113300010225WheatMSLCCTVGYKWVTAVMDGVKFEFNDIISLYKQNDSERNLSVR
Ga0136160_108162713300010225WheatMSLCCTVGYKWITVMDGVKFEFNDIISLYKKNDSERKRSVS
Ga0136160_108274313300010225WheatMSLCCTVGYKWVTVMDGVKFEFNDIISLYKKNDSERKRSVSL*C
Ga0136160_108494123300010225WheatMSLCCTVGYK*VTVMDGVKFEFNDIISLYKKNDSERK
Ga0136160_108593113300010225WheatMSLCCTVGDKWVIVMNGVKFEFNDIISLYKKNDSERKRSVSL*
Ga0136160_108856913300010225WheatMSL*CTVGDKWVTVMDGVKFEFNDRISLYKIYDSE*
Ga0136160_108965013300010225WheatMSLCCTVDYK*VTVMDGVKFKFNDLISLYKKNDSER
Ga0136160_109009913300010225WheatMSLCCTVGYKWVTIMDGVKFEFNDIISLYKKNDSERKRSVRL*C
Ga0136160_109161513300010225WheatMSLCCTVGYKWITVMDGVKFEFNDIISLYKKNDSERKRSVSL*
Ga0136160_109194113300010225WheatMSLCCTVGYKWVTVMDDDKFEFNDIISLYKKNDSERK
Ga0136160_109253213300010225WheatCTVGYKWVTVMDGVKFEFNDIISLYKKNDSERRRSVIL*
Ga0136160_109279813300010225WheatVSKWISLCCTVGDKCVTVMGGVKFEFNDILSLYKKNDSERKQSLSL*YY
Ga0136160_109312323300010225WheatMSICCTVGYKWDTVMDGVKFEFNDIISLYKKNDSERKRSVSL
Ga0136160_109330913300010225WheatMGKWVSLCCTEVNKRVTVMDGVKFEFNDIISLCKKNDSERKRS
Ga0136160_109388613300010225WheatVDALLCCTVGYKWVTVMDGVKFEFNDIISLYKKNDS
Ga0136160_109482913300010225WheatMSLCCIVGYKWVTLMDGVKFEFNDIISLYKKNDSERKRSVSL*
Ga0136160_109634333300010225WheatVGKWMSLCCTVGYKWVTVMDGVKFEYNDIISLYKKNDSERKQSVSL*
Ga0136160_110127113300010225WheatKMGKWMSLCCTVGYKWVTVMDGVKFEFNDTISLYTRNDFER*
Ga0136160_110321913300010225WheatMAGKWMSLCCTVGYKWITVIGGVKFKFNDIISLYKKMILSENF
Ga0136160_110389413300010225WheatVSFCCTVGYKWITVMDGVKFEFNDIISLYKKNDSERKRSVS
Ga0136160_110450423300010225WheatMSLCCTIGYKWVTVMDGVKFEFNDIISLYKKNDSERKR
Ga0136160_110464013300010225WheatMFLCYTLDYKWVTVMDGVKFEINYIMSLYKKNDSERKRSVNL*
Ga0136160_110744713300010225WheatMSLCCTVSYKWINLIDGVKFEFNDIISLHKKNDSERKWSVN
Ga0136160_110818413300010225WheatMSLCCTVDYKWVTAMDGVKFEFNDDIISLYKKKDSE*
Ga0136160_110948113300010225WheatMNIWMSLFCTVGYKCVTVMDGVKFEFNDIISLYKKNGQSAYD
Ga0136160_111106123300010225WheatVGKWVSLICTVGYK*VTVMDGVKFEFNDIISLYKKNDSERK
Ga0136160_111134113300010225WheatVGKLVSLCYIIGYKWVTVMDGVKFEFNDIILSLYKKN
Ga0136160_111190213300010225WheatMSRTNKKKWMSLCCTVGYKWVTVMDGVKFEYNDIISLYKKNDSERKQSVSL*
Ga0136160_111228713300010225WheatMGKWMSLCCTVGCKWVIVMDGVKFEFNDILSLYKKNVQSAYD
Ga0136160_111794213300010225WheatMMSLCCTVGCKWVTVMDGVKFEFNDIISLYKKNDSEQKRPVSLYYQVYFMILL*
Ga0136160_112281913300010225WheatMPLCCTVGYKCVTVMDGVKFEFNDIISLYKKNGQSAYD
Ga0136160_112426023300010225WheatVSKWTLFCCTVGYK*VTVMDGVKFEFNDIISLYKKNDSERK
Ga0136160_112724713300010225WheatMSLCCTVGDKCVTVMGVVKFEFNDIISLYKKNDSERKRSVSL*YYQ
Ga0136160_113370313300010225WheatMSLRCTVGYIWVTVMDGVKFELNDIISLYKKNDSERKRSVSL*
Ga0136160_113974113300010225WheatMSLCCTVGSKWVTVMDGVKFEFNDIISMYTKKDSERRRIISL
Ga0136160_114506613300010225WheatMSLCCTVGYKWVIVMDGVKFEFNDIISLYKKNDSERKRSDRL
Ga0136160_114784413300010225WheatMTLCCTVGYKWVTIMDGVKFEINDMISLYKKNDSERKRSVNL*
Ga0136160_115136213300010225WheatMGKWMSLCCTVGYKWDTVMDGVKFEFNDIISLYKKNDSERKRSVSL
Ga0136160_115651213300010225WheatVGKWISLCSTVGYEWVTVMDGVKFEFNDIISLYKKNDSEQK
Ga0136160_115842213300010225WheatVDKWILLCCTVGYK*VTVMDGVKFEFNDIISLYKKNDSERK
Ga0136160_115880313300010225WheatMSLYCIVGYKWVTVMDGVKFKFNDIISLYKKNDSE
Ga0136160_116089913300010225WheatMLLCCTVGYKWVTVMGVKFEFNDIISLYKKNDSEQKRSVSL
Ga0136160_116497213300010225WheatMKKSGKWMSLSCTVGYKWVTVMDCIKSESLYKKNDF
Ga0136160_116643513300010225WheatMSLCCAVGDKWVTVMDGVKFEFNDIISLYKKKRF*
Ga0136160_117086013300010225WheatMSLCCTVGYKWVTVIDGVKFKFNDIISLYKKDDSERKRSVR
Ga0136160_117635723300010225WheatMSLCCTVGYKWVTVMNGVTFEFNDIISLYKKNDFERKRSVSLW
Ga0136160_117962513300010225WheatCCTVGYKWVTVMDGVKFEFNDIISLYKKSDSERKRSVSL*
Ga0136160_117976013300010225WheatVSLCCTEVYKWATIMDGVKFEFNDIISLYKKNDSERKRSVRL
Ga0136160_118119713300010225WheatVSLCCTVGYKWATVMDGVKFEFNDIISLYKKNDSERKQ
Ga0136160_118213413300010225WheatVGKWISLCCAVGYKWVTVIDDVKFEFNDIKSLYKKND
Ga0136160_118702713300010225WheatMSLCCTVGYKWITVMDGVKFEFNDIISLYKKNDSE
Ga0136160_118782213300010225WheatVLLCCTVGYKWITVMDGVTFEFNDIISLYMKHDSER*
Ga0136160_118922133300010225WheatVGKWVSLCCTVGYKWVTVMDGVKFEFNDIISLYKKND
Ga0136160_118960413300010225WheatMSLFWTVDDKWVTVMDGVKFEFNDIISSYKKNDSGRKR
Ga0136160_119391213300010225WheatMLLCCKIGFKWVTVMDGVKFEFNDLISLYKKK*I*M
Ga0136160_119851813300010225WheatMSLCCTAVGYKWITVMDGVKFEFNDIISLYKKNDSERKRSVS
Ga0136160_120345013300010225WheatMSL*CTVGYKWVTVMDGVKFEFNNIISLYKKNANINI
Ga0136160_120497413300010225WheatVGKWISLCCKVGYKWVTVMDGVKFEFNDLISLYKINDS
Ga0136160_120726113300010225WheatMSLCCTEGYKWFTVMDGVKFEFNDIISLYNKNDSERKRSVSQPMI*
Ga0308176_1065803213300031996SoilLWCTVAYKWVTVMDGIKFEFNDIISLYTKNDSDRRRVFSLGY


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.