NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300009539

3300009539: Microbial communities of aphids from Brassica oleracea in Tucson, AZ, USA - Brevicoryne brassicae seqcov



Overview

Basic Information
IMG/M Taxon OID3300009539 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0118459 | Gp0139337 | Ga0127521
Sample NameMicrobial communities of aphids from Brassica oleracea in Tucson, AZ, USA - Brevicoryne brassicae seqcov
Sequencing StatusPermanent Draft
Sequencing CenterUniversity of Texas, Austin
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size281683917
Sequencing Scaffolds4
Novel Protein Genes4
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available2
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini1
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis → Aphis craccivora1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameHost-Associated Microbial Communities Of Aphids From Plants In Several Locations Around Usa
TypeHost-Associated
TaxonomyHost-Associated → Arthropoda → Aphids → Unclassified → Unclassified → Brassica Oleracea → Host-Associated Microbial Communities Of Aphids From Plants In Several Locations Around Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Host-associated → Animal → Animal corpus

Location Information
LocationTucson, AZ, USA
CoordinatesLat. (o)32.23184Long. (o)-110.950699Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F029983Metagenome186Y
F060091Metagenome133Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0127521_114866Not Available1422Open in IMG/M
Ga0127521_118266All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini3988Open in IMG/M
Ga0127521_146264All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis → Aphis craccivora1806Open in IMG/M
Ga0127521_168310Not Available1479Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0127521_114866Ga0127521_1148661F029983MSLCCTVGYKLVTVMDGXXFEFNDLISSYTKNDSEWRRFV
Ga0127521_118266Ga0127521_1182664F029983MSLCCTVGYKWVNVLDGIIYFEFNDIISLYTKNDSXXXRFVSLGFFTLD*
Ga0127521_146264Ga0127521_1462641F060091MDELHDLNYKLDLSSESDSDEEMNELLLLYSLSKRNKSIWKSAYMKKRKSYGEFILTSEFSDKQFTNYFRLNRNQFNEVLSVVNDKIYSVGCNAQKPIDPEEKLAVFLR*
Ga0127521_168310Ga0127521_1683101F029983MSLCCTVVYKWITVKDGIKFEFNDIINDSDRRRVLSLGYFI

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.