Sample 3300009493

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300009493

3300009493: Microbial communities of aphids from witch-hazel in New Haven, CT, USA - Hormaphis hamamelidis NM061510_01 seqcov

Overview

Basic Information
IMG/M Taxon OID	3300009493 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0118459 \| Gp0136421 \| Ga0127654
Sample Name	Microbial communities of aphids from witch-hazel in New Haven, CT, USA - Hormaphis hamamelidis NM061510_01 seqcov
Sequencing Status	Permanent Draft
Sequencing Center	University of Texas, Austin
Published?	N
Use Policy	Open

Dataset Contents
Total Genome Size	191563800
Sequencing Scaffolds	2
Novel Protein Genes	2
Associated Families	1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	2

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Host-Associated Microbial Communities Of Aphids From Plants In Several Locations Around Usa
Type	Host-Associated
Taxonomy	Host-Associated → Insecta → Unclassified → Unclassified → Unclassified → Witch-Hazel → Host-Associated Microbial Communities Of Aphids From Plants In Several Locations Around Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	Unclassified
Earth Microbiome Project Ontology (EMPO)	Host-associated → Animal → Animal corpus

Location Information
Location	USA: West Haven, Connecticut
Coordinates	Lat. (^o)	41.257945	Long. (^o)	-72.989398	Alt. (m)	N/A	Depth (m)	N/A
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F029983	Metagenome	186	Y

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
Ga0127654_153383	Not Available	2070	Open in IMG/M
Ga0127654_166991	Not Available	2268	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0127654_153383	Ga0127654_1533831	F029983	MSLCCTVDYKWVAVMEGVKFEFNDISFYKKNDSER
Ga0127654_166991	Ga0127654_1669911	F029983	VSLYCTVGYKWETVMDGVIKFEFNDIISLYKINDCERRRSV

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.