NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300009479

3300009479: Microbial communities of aphids from Triticum aestivum in Marana, AZ, USA - Sitobion avenae seqcov



Overview

Basic Information
IMG/M Taxon OID3300009479 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0118459 | Gp0139340 | Ga0127529
Sample NameMicrobial communities of aphids from Triticum aestivum in Marana, AZ, USA - Sitobion avenae seqcov
Sequencing StatusPermanent Draft
Sequencing CenterUniversity of Texas, Austin
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size255311039
Sequencing Scaffolds8
Novel Protein Genes8
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available3
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini2
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda1
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Macrosiphini → Acyrthosiphon → Acyrthosiphon pisum1
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameHost-Associated Microbial Communities Of Aphids From Plants In Several Locations Around Usa
TypeHost-Associated
TaxonomyHost-Associated → Arthropoda → Aphids → Unclassified → Unclassified → Wheat → Host-Associated Microbial Communities Of Aphids From Plants In Several Locations Around Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Host-associated → Animal → Animal corpus

Location Information
LocationMarana, AZ, USA
CoordinatesLat. (o)32.436857Long. (o)-111.228276Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F029983Metagenome186Y
F060091Metagenome133Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0127529_1008064Not Available2576Open in IMG/M
Ga0127529_1016164Not Available1024Open in IMG/M
Ga0127529_1020501All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini2113Open in IMG/M
Ga0127529_1035863All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda2754Open in IMG/M
Ga0127529_1050879Not Available2096Open in IMG/M
Ga0127529_1055953All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Macrosiphini → Acyrthosiphon → Acyrthosiphon pisum4240Open in IMG/M
Ga0127529_1065091All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini1817Open in IMG/M
Ga0127529_1067652All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis4661Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0127529_1008064Ga0127529_10080641F029983MSHCCTVGYKWVAIMDGFNFKSNDIISLYNKNDSERKQSV
Ga0127529_1016164Ga0127529_10161641F029983VGXXXSLCCTVGYKEVTVMDGXXXEFDDIISLYKKND
Ga0127529_1020501Ga0127529_10205011F029983MSLCSTVGFKWVTVMDGVKFQFNDIISLYKKNGQSAY
Ga0127529_1035863Ga0127529_10358636F060091MMAHELFKLDLSSESDSDEELDELVLYSLIKRKKSRNSDFMKKRKSYREFVLTKELSEKQFTNYFRLNRFQFHEVLHIIKDTIFSEECNAQRPIEPEEKLAVFLR*
Ga0127529_1050879Ga0127529_10508791F029983MSLCCTVGYKWVTVMDGVKFEFNDIIWLYKKNDSE
Ga0127529_1055953Ga0127529_10559531F029983VSLXXTEVYKWDTVMDGVKXEFNDIILLYEKNNSERKRSV
Ga0127529_1065091Ga0127529_10650912F060091MGEQHDLNYKLDLSSESDSDEEMNELLLLYSLSKRNKSIWKSEYMKKRKSHGEFILTSEFSDKQFTNYFRLNRNQFNEVLSIVNDKIYSVGCNAQKPIDPEEKLAVFLR*
Ga0127529_1067652Ga0127529_10676522F029983MSLCCTVGDKLVTVMDGVKXEFNDIISXXXXXDSERKRTVSL*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.