x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our
privacy policy .
OK
Sample 3300009531
3300009531: Microbial communities of aphids from cabbage in Tucson, AZ, USA - Lipaphis pseudobrassicae NM032704 seqcov
Overview
Basic Information
IMG/M Taxon OID 3300009531 Open in IMG/M GOLD Reference Gs0118459 | Gp0139335 | Ga0127525 Sample Name Microbial communities of aphids from cabbage in Tucson, AZ, USA - Lipaphis pseudobrassicae NM032704 seqcov Sequencing Status Permanent Draft Sequencing Center University of Texas, Austin Published? N Use Policy Open
Dataset Contents
Total Genome Size 206796682 Sequencing Scaffolds 1 Novel Protein Genes 1 Associated Families 1
Dataset Phylogeny
Taxonomy Groups Number of Scaffolds All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae 1
Ecosystem and Geography
Ecosystem Assignment (GOLD)
Name Host-Associated Microbial Communities Of Aphids From Plants In Several Locations Around Usa Type Host-Associated Taxonomy Host-Associated → Arthropoda → Aphids → Unclassified → Unclassified → Cabbage → Host-Associated Microbial Communities Of Aphids From Plants In Several Locations Around Usa
Alternative Ecosystem Assignments
Environment Ontology (ENVO) Unclassified Earth Microbiome Project Ontology (EMPO) Host-associated → Animal → Animal corpus
Location Information
Location Tucson, AZ, USA Coordinates Lat. (o ) 32.23184 Long. (o ) -110.950699 Alt. (m) N/A Depth (m) N/A Location on Map
Zoom: - Reset +
Powered by OpenStreetMap ©
Associated Families
Family Category Number of Sequences 3D Structure?
F029983 Metagenome 186 Y
Associated Scaffolds
Scaffold Taxonomy Length IMG/M Link Ga0127525_120133 All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae 3571 Open in IMG/M
Sequences
Scaffold ID Protein ID Family Sequence
Ga0127525_120133 Ga0127525_1201332 F029983 MSLCCTVAYEWITVMDVIKFEFNDIITLYMKNDSELSQLSV*
