 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300009468 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0118459 | Gp0139336 | Ga0127530 |
| Sample Name | Microbial communities of aphids from Rosa in Tucson, AZ, USA - Wahlgreniella nervata seqcov |
| Sequencing Status | Permanent Draft |
| Sequencing Center | University of Texas, Austin |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 199344178 |
| Sequencing Scaffolds | 5 |
| Novel Protein Genes | 5 |
| Associated Families | 1 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| Not Available | 4 |
| All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Host-Associated Microbial Communities Of Aphids From Plants In Several Locations Around Usa |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Arthropoda → Aphids → Unclassified → Unclassified → Rosa → Host-Associated Microbial Communities Of Aphids From Plants In Several Locations Around Usa |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal corpus |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Tucson, AZ, USA | |||||||
| Coordinates | Lat. (o) | 32.23184 | Long. (o) | -110.950699 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F029983 | Metagenome | 186 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0127530_104952 | Not Available | 1871 | Open in IMG/M |
| Ga0127530_107241 | Not Available | 2168 | Open in IMG/M |
| Ga0127530_141853 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha | 1236 | Open in IMG/M |
| Ga0127530_145771 | Not Available | 1222 | Open in IMG/M |
| Ga0127530_167013 | Not Available | 1373 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0127530_104952 | Ga0127530_1049521 | F029983 | MSLFCTVGYKVGQCITDCIKFELNDIISLYRKNDSE |
| Ga0127530_107241 | Ga0127530_1072411 | F029983 | MSIFCTVGYKWVTVMNGVKFELNDIISLNTKNDSERR |
| Ga0127530_141853 | Ga0127530_1418531 | F029983 | VSICCTIGYKWVTIIDVVKFEFNDKKSLYKKNASKRRLSV |
| Ga0127530_145771 | Ga0127530_1457712 | F029983 | VSLCCIVGYKLVTVMNGVQFEFNDKISLYKKNGSERR |
| Ga0127530_167013 | Ga0127530_1670131 | F029983 | VLXXCTVGYKRGTVMDGVIFKFNDIXSLYKKNDSERRQ |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |