Basic Information | |
---|---|
IMG/M Taxon OID | 3300009535 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0118459 | Gp0139339 | Ga0127526 |
Sample Name | Microbial communities of aphids from Calyophus hartwegii in Tucson, AZ, USA - Macrosiphum gaurae seqcov |
Sequencing Status | Permanent Draft |
Sequencing Center | University of Texas, Austin |
Published? | N |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 265644161 |
Sequencing Scaffolds | 7 |
Novel Protein Genes | 7 |
Associated Families | 2 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
Not Available | 5 |
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini | 1 |
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Macrosiphini → Acyrthosiphon → Acyrthosiphon pisum | 1 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Host-Associated Microbial Communities Of Aphids From Plants In Several Locations Around Usa |
Type | Host-Associated |
Taxonomy | Host-Associated → Arthropoda → Aphids → Unclassified → Unclassified → Calyophus Hartwegii → Host-Associated Microbial Communities Of Aphids From Plants In Several Locations Around Usa |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | Unclassified |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal corpus |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | Tucson, AZ, USA | |||||||
Coordinates | Lat. (o) | 32.23184 | Long. (o) | -110.950699 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F029983 | Metagenome | 186 | Y |
F060091 | Metagenome | 133 | Y |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
Ga0127526_1003942 | Not Available | 1771 | Open in IMG/M |
Ga0127526_1007566 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini | 6302 | Open in IMG/M |
Ga0127526_1008954 | Not Available | 1069 | Open in IMG/M |
Ga0127526_1029689 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Macrosiphini → Acyrthosiphon → Acyrthosiphon pisum | 1305 | Open in IMG/M |
Ga0127526_1060880 | Not Available | 1465 | Open in IMG/M |
Ga0127526_1077605 | Not Available | 2844 | Open in IMG/M |
Ga0127526_1089232 | Not Available | 1001 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
Ga0127526_1003942 | Ga0127526_10039421 | F029983 | MSLYCTVGFKCRGCMDGVKFEFNNIIPLYKXNDSERKRS |
Ga0127526_1007566 | Ga0127526_10075664 | F060091 | MDELHDLNYKLDLSSESDSDEEMNELLLLYSLSKRNKSIWKSAYMKKRKSHGEFILTSEFSDKQFTNYFRLNRNQFNEVLSIVNDKIYLVGCNAQKPIDPEEKLAVFLR* |
Ga0127526_1008954 | Ga0127526_10089542 | F029983 | VGKWMSLXCTVDYKWVTLMDGFTFEFNDIISLYKQ |
Ga0127526_1029689 | Ga0127526_10296891 | F029983 | LCCTVGYKWVTVMDCVKFEFNXXISLYTKNDSER* |
Ga0127526_1060880 | Ga0127526_10608801 | F029983 | MSLCCTVGYKWITDHCIMDCIRFEFNDIISLYRYTKNDSERRRFV |
Ga0127526_1077605 | Ga0127526_10776051 | F029983 | MSLCYTXXYKWVTVMDFVKFELKDIISLYKXNDSERKR |
Ga0127526_1089232 | Ga0127526_10892321 | F029983 | MSLCCTVGYKWVTVMDDVKFESNXXISLYTKKILSENG |
⦗Top⦘ |