NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300009473

3300009473: Microbial communities of aphids from lettuce in Tucson, AZ, USA - Acyrthosiphon lactucae NM052899 seqcov



Overview

Basic Information
IMG/M Taxon OID3300009473 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0118459 | Gp0138843 | Ga0127520
Sample NameMicrobial communities of aphids from lettuce in Tucson, AZ, USA - Acyrthosiphon lactucae NM052899 seqcov
Sequencing StatusPermanent Draft
Sequencing CenterUniversity of Texas, Austin
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size249644053
Sequencing Scaffolds4
Novel Protein Genes4
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available2
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis1
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Kalotermitidae → Cryptotermitinae → Cryptotermes → Cryptotermes secundus1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameHost-Associated Microbial Communities Of Aphids From Plants In Several Locations Around Usa
TypeHost-Associated
TaxonomyHost-Associated → Insecta → Unclassified → Unclassified → Unclassified → Lettuce → Host-Associated Microbial Communities Of Aphids From Plants In Several Locations Around Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Host-associated → Animal → Animal corpus

Location Information
LocationTucson, AZ, USA
CoordinatesLat. (o)32.23184Long. (o)-110.950699Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F029983Metagenome186Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0127520_1009776Not Available2415Open in IMG/M
Ga0127520_1011186All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis2078Open in IMG/M
Ga0127520_1028733All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Kalotermitidae → Cryptotermitinae → Cryptotermes → Cryptotermes secundus4336Open in IMG/M
Ga0127520_1041464Not Available2796Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0127520_1009776Ga0127520_10097761F029983MYKKVGKYMSLRCSVGYKLVTVMNGVKFEFNDIKSLYKKNDTERK
Ga0127520_1011186Ga0127520_10111861F029983MSLCCTVGYKWVTVMDGVRFEFNDIISSYTKNDSERRRLVS
Ga0127520_1028733Ga0127520_10287331F029983VAK*MSLCCTVDYKWVAVMDGVKFEFNNIVSLYKKNGQ
Ga0127520_1041464Ga0127520_10414641F029983MSLWCTIGYKWVFVMDCGKFEFNDKLLLYKKNDSERRRTTSL*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.