NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0115203_135573

Scaffold Ga0115203_135573


Overview

Basic Information
Taxon OID3300008460 Open in IMG/M
Scaffold IDGa0115203_135573 Open in IMG/M
Source Dataset NameMicrobial communities of aphids from sagebrush in Onefour, Alberta, CA - Artemisaphis artemisicola CNC#HEM063374
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Texas, Austin
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1102
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Insecta → Unclassified → Unclassified → Unclassified → Sagebrush → Host-Associated Microbial Communities Of Aphids From Plants In Several Locations Around Usa

Source Dataset Sampling Location
Location NameOnefour, Alberta, CA
CoordinatesLat. (o)49.115537Long. (o)-110.468757Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F029983Metagenome186Y

Sequences

Protein IDFamilyRBSSequence
Ga0115203_1355731F029983N/AMTLCCTVDYKCVTVMDGVKFELNYIILLYTKNDA*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.