Basic Information | |
---|---|
Taxon OID | 3300008786 Open in IMG/M |
Scaffold ID | Ga0103639_1000937 Open in IMG/M |
Source Dataset Name | Microbial communities from wetland soil in Czech Republic - M3_cDNA |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | Friedrich Schiller University of Jena |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1074 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Wetlands → Unclassified → Wetland Soil → Microbial Communities From Wetland Soil In Czech Republic |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Czech Republic | |||||||
Coordinates | Lat. (o) | 50.14667 | Long. (o) | 12.45083 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F077206 | Metagenome / Metatranscriptome | 117 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0103639_10009371 | F077206 | N/A | GFEVRVFVNGSPKTTVDANKRNELRACMTAAGLTPDEVNEKVHELYITNTTEFVGSR* |
⦗Top⦘ |