Scaffold Ga0103639_1003954

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0103639_1003954

Scaffold Ga0103639_1003954

Overview

Basic Information
Taxon OID	3300008786 Open in IMG/M
Scaffold ID	Ga0103639_1003954 Open in IMG/M
Source Dataset Name	Microbial communities from wetland soil in Czech Republic - M3_cDNA
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	Friedrich Schiller University of Jena
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	661
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Wetlands → Unclassified → Wetland Soil → Microbial Communities From Wetland Soil In Czech Republic

Source Dataset Sampling Location
Location Name	Czech Republic
Coordinates	Lat. (^o)	50.14667	Long. (^o)	12.45083	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F098626	Metagenome / Metatranscriptome	103	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0103639_10039542	F098626	GGAGG	MELGLDQAIMDTPVAREIQHQLQEWLRSRCPDHLGAIMEKMKN*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.