NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0103639_1008465

Scaffold Ga0103639_1008465


Overview

Basic Information
Taxon OID3300008786 Open in IMG/M
Scaffold IDGa0103639_1008465 Open in IMG/M
Source Dataset NameMicrobial communities from wetland soil in Czech Republic - M3_cDNA
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterFriedrich Schiller University of Jena
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)512
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Wetlands → Unclassified → Wetland Soil → Microbial Communities From Wetland Soil In Czech Republic

Source Dataset Sampling Location
Location NameCzech Republic
CoordinatesLat. (o)50.14667Long. (o)12.45083Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F010404Metagenome / Metatranscriptome304Y

Sequences

Protein IDFamilyRBSSequence
Ga0103639_10084651F010404AGAAGMQPFTLLQRRSALRQIPAAGSTLLAYIFEAALEFQSARSASRSRPRLAFFRLTGLDRCESPVANFLS*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.