NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0058709_10640

Scaffold Ga0058709_10640


Overview

Basic Information
Taxon OID3300009097 Open in IMG/M
Scaffold IDGa0058709_10640 Open in IMG/M
Source Dataset NameBulk soil microbial communities from Harvard Forest, USA - 2Bulk_unsorted metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)550
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Bulk Soil → Rhizosphere And Bulk Soil Microbial Communities From Harvard Forest, Usa

Source Dataset Sampling Location
Location NameHarvard Forest, Massachusetts, USA
CoordinatesLat. (o)42.5502Long. (o)-72.1737Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F103737Metagenome / Metatranscriptome101Y

Sequences

Protein IDFamilyRBSSequence
Ga0058709_106401F103737N/AKQVLPFHGPVRFDRYLPASNKVSGRIVMGKDFDSQMGTGHKVYMNVGSNQGVKIGDFFRAVRSYEADLKDPVDSLSFRAAMAEDTQKKMPSFDPQLFEKENGPVIHVRDLPRRAIGEIVIIGVTDTTATGMIVFAMEDVHAGDGVELDQVN*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.