NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300009097

3300009097: Bulk soil microbial communities from Harvard Forest, USA - 2Bulk_unsorted metaG



Overview

Basic Information
IMG/M Taxon OID3300009097 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0053064 | Gp0104121 | Ga0058709
Sample NameBulk soil microbial communities from Harvard Forest, USA - 2Bulk_unsorted metaG
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size3284153
Sequencing Scaffolds4
Novel Protein Genes4
Associated Families4

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available2
All Organisms → cellular organisms → Bacteria1
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameRhizosphere And Bulk Soil Microbial Communities From Harvard Forest, Usa
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Bulk Soil → Rhizosphere And Bulk Soil Microbial Communities From Harvard Forest, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)forest biome → land → bulk soil
Earth Microbiome Project Ontology (EMPO)Host-associated → Plant → Plant rhizosphere

Location Information
LocationHarvard Forest, Massachusetts, USA
CoordinatesLat. (o)42.5502Long. (o)-72.1737Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F015388Metagenome / Metatranscriptome255Y
F065416Metagenome / Metatranscriptome127Y
F099756Metagenome / Metatranscriptome103Y
F103737Metagenome / Metatranscriptome101Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0058709_10073Not Available788Open in IMG/M
Ga0058709_10474All Organisms → cellular organisms → Bacteria577Open in IMG/M
Ga0058709_10612Not Available553Open in IMG/M
Ga0058709_10640All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium550Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0058709_10073Ga0058709_100731F065416MSPTRSGYKELGLELVEPLQDQPRKSRRPPMADEKKDEGAGDPIKILLEEALERQRNAMMDSFAQIL*
Ga0058709_10474Ga0058709_104742F015388MSGAAYIPPRREGRRYEAVLCLSEALSLCSEPEDLTKILSEELREFLAFLQFYIIIYKENSTEVEWAVVGREQSLVAAYADVPVEQRPSWQAYTTQEPFHIHDWRTDERVPRRLKLGIAA
Ga0058709_10612Ga0058709_106122F099756VTRERIEQFFKNLASALGRCIFEDAEVLGMVIPALVCVSILWLIGVAVYDFILNPYLTMAATLDSLSINPDKWIPR*
Ga0058709_10640Ga0058709_106401F103737KQVLPFHGPVRFDRYLPASNKVSGRIVMGKDFDSQMGTGHKVYMNVGSNQGVKIGDFFRAVRSYEADLKDPVDSLSFRAAMAEDTQKKMPSFDPQLFEKENGPVIHVRDLPRRAIGEIVIIGVTDTTATGMIVFAMEDVHAGDGVELDQVN*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.