Scaffold Ga0113563_11403141

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0113563_11403141

Scaffold Ga0113563_11403141

Overview

Basic Information
Taxon OID	3300009167 Open in IMG/M
Scaffold ID	Ga0113563_11403141 Open in IMG/M
Source Dataset Name	Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	820
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands → Freshwater Wetland Microbial Communities From Ohio, Usa, Analyzing The Effect Of Biotic And Abiotic Controls

Source Dataset Sampling Location
Location Name	USA: Ohio, Lake Erie, Old Woman Creek
Coordinates	Lat. (^o)	41.384	Long. (^o)	-82.513	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F065641	Metagenome / Metatranscriptome	127	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0113563_114031411	F065641	N/A	QLQKCYESNFAEAGGFSDDLRQICALIGVNGLFQMLEGSHSQRVHETIWHLLLPKLRPGLRRWYQRSGAAKDPTAVALRDHLSQLAGEKLGDKTGFPHHPS*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.