NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0116854_1004362

Scaffold Ga0116854_1004362


Overview

Basic Information
Taxon OID3300009400 Open in IMG/M
Scaffold IDGa0116854_1004362 Open in IMG/M
Source Dataset NameSoil microbial community of the Robinson Ridge, Antarctica. Combined Assembly of Gp0139162, Gp0138857, Gp0138858
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Queensland
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1052
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil Microbial Community Of The Robinson Ridge, Antarctica

Source Dataset Sampling Location
Location NameRobinson Ridge, Antarctica
CoordinatesLat. (o)-66.369451Long. (o)110.585574Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F075353Metagenome / Metatranscriptome119Y

Sequences

Protein IDFamilyRBSSequence
Ga0116854_10043622F075353N/AMEDLELEHAELLPSRETLWVCHHPSQYGSNFSFTQVAXNTNQAGFLNISALNGNLSGNSISL*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.