NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0115005_10213927

Scaffold Ga0115005_10213927


Overview

Basic Information
Taxon OID3300009432 Open in IMG/M
Scaffold IDGa0115005_10213927 Open in IMG/M
Source Dataset NameMarine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M Metagenome
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1505
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (80.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Eukaryotic Phytoplankton Communities From The Norwegian Sea, Arctic And Atlantic Ocean

Source Dataset Sampling Location
Location NameArctic Ocean
CoordinatesLat. (o)79.0225Long. (o)-9.5247Alt. (m)Depth (m)17
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000107Metagenome / Metatranscriptome2222Y
F078814Metagenome / Metatranscriptome116N

Sequences

Protein IDFamilyRBSSequence
Ga0115005_102139271F078814N/APAEKQAVKDVFTLLGNTKGEIISKVDSIVKQVAKKRNVKISSIEDYFDNEILN*
Ga0115005_102139273F000107GGTGGVTIANTKVVDNTSKYIVQSKGIGSETDQVVVDAEELASGNNKSLVSLIECYYLIEGTGTLTLSTSSEENDLTLTGKGKYGLRPDQLKFGNDKQMLLTTDSNVESYLLVSEFRRNN*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.