NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0127519_121564

Scaffold Ga0127519_121564


Overview

Basic Information
Taxon OID3300009454 Open in IMG/M
Scaffold IDGa0127519_121564 Open in IMG/M
Source Dataset NameMicrobial communities of aphids from sagebrush in Onefour, Alberta, CA - Artemisaphis artemisicola CNC#HEM063374 seqcov
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Texas, Austin
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2369
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis → Aphis craccivora(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Insecta → Unclassified → Unclassified → Unclassified → Sagebrush → Host-Associated Microbial Communities Of Aphids From Plants In Several Locations Around Usa

Source Dataset Sampling Location
Location NameOnefour, Alberta, CA
CoordinatesLat. (o)49.115537Long. (o)-110.468757Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F029983Metagenome186Y

Sequences

Protein IDFamilyRBSSequence
Ga0127519_1215641F029983GGCGGMSLCCTVDYKWVTVMDGIKYEFNDIILLHKNHMI*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.