 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Taxon OID | 3300009456 Open in IMG/M |
| Scaffold ID | Ga0127523_103103 Open in IMG/M |
| Source Dataset Name | Microbial communities of aphids from Ribes sp. in Pocatello, ID, USA - Hyperomyzus lactucae CVD94-86 seqcov |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Texas, Austin |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 3584 |
| Total Scaffold Genes | 5 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Macrosiphini → Myzus → Myzus persicae | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Insecta → Unclassified → Unclassified → Unclassified → Ribes Sp. → Host-Associated Microbial Communities Of Aphids From Plants In Several Locations Around Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Pocatello, ID, USA | |||||||
| Coordinates | Lat. (o) | 42.899137 | Long. (o) | -112.461301 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F060091 | Metagenome | 133 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0127523_1031032 | F060091 | N/A | MSVSDSMMAENLINLSSESDSDDEFDELILLYSLTKQKKMWKSNFMKKRQSHGEFNLSSEFSDKQFLNYFRLDRKQFNEVLHLIRDTIYSFGCNAQKPIDPEEKLAVFLR* |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |