Scaffold Ga0127522_109119

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0127522_109119

Scaffold Ga0127522_109119

Overview

Basic Information
Taxon OID	3300009477 Open in IMG/M
Scaffold ID	Ga0127522_109119 Open in IMG/M
Source Dataset Name	Microbial communities of aphids from Cirsium sp. in Ottawa, Ontario, CA - Brachycaudus cardui CNC#HEM061370 seqcov
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Texas, Austin
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	4971
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (33.33%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Insecta → Unclassified → Unclassified → Unclassified → Cirsium Sp. → Host-Associated Microbial Communities Of Aphids From Plants In Several Locations Around Usa

Source Dataset Sampling Location
Location Name	Ottawa, Ontario, CA
Coordinates	Lat. (^o)	45.4516	Long. (^o)	-75.68045	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F029983	Metagenome	186	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0127522_1091192	F029983	AGGA	MSLCCTVGYKWVTVMDGIKFEFSYVKSFYMKNDSERRWSVSL*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.