Scaffold Ga0127651_108962

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0127651_108962

Scaffold Ga0127651_108962

Overview

Basic Information
Taxon OID	3300009483 Open in IMG/M
Scaffold ID	Ga0127651_108962 Open in IMG/M
Source Dataset Name	Microbial communities of aphids from Rhus glabra galls in Chiricahua Mtns, AZ, USA - Melaphis rhois NM090294 seqcov
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Texas, Austin
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	5935
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (25.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Insecta → Unclassified → Unclassified → Unclassified → Rhus Glabra → Host-Associated Microbial Communities Of Aphids From Plants In Several Locations Around Usa

Source Dataset Sampling Location
Location Name	Chiricahua Mtns, AZ, USA
Coordinates	Lat. (^o)	31.934752	Long. (^o)	-109.3828	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F013193	Metagenome	273	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0127651_1089624	F013193	N/A	MHQHRPTLEAPKEVIAQEVAAIPPEMTRKVIDNYRETLDRCIENEGRHLSDVIFKNS

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.