Scaffold Ga0105159_1000362

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0105159_1000362

Scaffold Ga0105159_1000362

Overview

Basic Information
Taxon OID	3300009590 Open in IMG/M
Scaffold ID	Ga0105159_1000362 Open in IMG/M
Source Dataset Name	Hot spring microbial communities from Little Hot Creek, USA to study Microbial Dark Matter (Phase II) - LHC4sed_replicate
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	12790
Total Scaffold Genes	13 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	5 (38.46%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Hot Spring → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)

Source Dataset Sampling Location
Location Name	USA: California, Little Hot Creek
Coordinates	Lat. (^o)	37.6906	Long. (^o)	-118.8442	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F074155	Metagenome	120	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0105159_10003622	F074155	GGAGG	MAANLLSFDFIRGRLSPEQLEDLAVSLGLCLECGGNLVSRDGEIVCSSCGFVWAVENTAYYVPFPEYESADGGERNHFEGHWQPGSTLAFLKGLGDPALANSRGKALMRVLAKSPNGATDLGLRARQVKTLVEWEDPPQLRRVLSRISLLLTQMGQRENWLLADYAGKLARKIVAFKLLTREPISYKLGDAIIAHTIKKFSLKASPPNLKVENEDLQLIRQLENITQKPKHPKPAYQATHSINSN*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.