Scaffold Ga0105156_1006439

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0105156_1006439

Scaffold Ga0105156_1006439

Overview

Basic Information
Taxon OID	3300009596 Open in IMG/M
Scaffold ID	Ga0105156_1006439 Open in IMG/M
Source Dataset Name	Hot spring microbial communities from Sandy's Spring West, USA to study Microbial Dark Matter (Phase II) - SSWTFFsm_matched
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1516
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (33.33%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Predicted Viral	(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)

Source Dataset Sampling Location
Location Name	USA: Nevada, Gerlach, Sandy's Spring West
Coordinates	Lat. (^o)	40.653	Long. (^o)	-119.3749	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F104050	Metagenome	101	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0105156_10064392	F104050	N/A	VSEVKKCIIRLRKHCVVYDGLISDERQKYGSKDYVITYCSMCIKTFYAKAKHKLVNKFSVVNTL*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.