NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0131972_11154

Scaffold Ga0131972_11154


Overview

Basic Information
Taxon OID3300009842 Open in IMG/M
Scaffold IDGa0131972_11154 Open in IMG/M
Source Dataset NameBacterial communities in Amundsen Sea Polynya. Combined Assembly of Gp0149108, Gp0149160, Gp0151052
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterMacrogen Inc
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1328
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine → Metagenomic Analysis Of Heterotrophic Bacteria Associated With Phytoplankton Bloom In Amundsen Sea Polynya

Source Dataset Sampling Location
Location NamePolynya in Amundsen Sea
CoordinatesLat. (o)-73.3Long. (o)-113.0Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F009761Metagenome / Metatranscriptome313Y

Sequences

Protein IDFamilyRBSSequence
Ga0131972_111541F009761N/ARQIKSINILKDPASIGGKDVFRASLLIGYELPKINIINKTKR*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.