Basic Information | |
---|---|
Taxon OID | 3300009870 Open in IMG/M |
Scaffold ID | Ga0131092_10902184 Open in IMG/M |
Source Dataset Name | Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Linkou plant |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Beijing Novogene Bioinformatics Technology Co., Ltd |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 725 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge → Activated Sludge Microbial Community Analysis In Wastewater Treatment Plant From Tai Wan |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Tai Wan | |||||||
Coordinates | Lat. (o) | 25.0 | Long. (o) | 121.0 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F086521 | Metagenome | 110 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0131092_109021842 | F086521 | N/A | SLSMSVQASPLSPVPASSAASAITLVRDGCGIGFHMAPCGCIRNYTACPVIVAPPVVVAPQYAPPVVATPAVCPYGYYLGPYGRCLPY* |
⦗Top⦘ |