Basic Information | |
---|---|
Taxon OID | 3300009945 Open in IMG/M |
Scaffold ID | Ga0117932_1078785 Open in IMG/M |
Source Dataset Name | Combined Assembly of Gp0139326, Gp0139349, Gp0139350, Gp0139351 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of Wisconsin, Madison |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 3986 |
Total Scaffold Genes | 6 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (66.67%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Neutral → Hot Spring Water Column → Stable Isotope Probing Incubations Of Microbial Communities From Chocolate Pots Hot Springs, Yellowstone National Park, Wyoming, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Chocolate Pots hot springs, Yellowstone National Park, Wyoming, USA | |||||||
Coordinates | Lat. (o) | 44.71538 | Long. (o) | -110.73627 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F046219 | Metagenome | 151 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0117932_10787853 | F046219 | AGCAGG | LLRRALDLRAALKLGVRLDLDEIRADEFAAILLIAEEVDVLEKERLSGQMGPR* |
⦗Top⦘ |