NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0117932_1081384

Scaffold Ga0117932_1081384


Overview

Basic Information
Taxon OID3300009945 Open in IMG/M
Scaffold IDGa0117932_1081384 Open in IMG/M
Source Dataset NameCombined Assembly of Gp0139326, Gp0139349, Gp0139350, Gp0139351
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Wisconsin, Madison
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1165
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Neutral → Hot Spring Water Column → Stable Isotope Probing Incubations Of Microbial Communities From Chocolate Pots Hot Springs, Yellowstone National Park, Wyoming, Usa

Source Dataset Sampling Location
Location NameChocolate Pots hot springs, Yellowstone National Park, Wyoming, USA
CoordinatesLat. (o)44.71538Long. (o)-110.73627Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F014829Metagenome / Metatranscriptome259Y

Sequences

Protein IDFamilyRBSSequence
Ga0117932_10813842F014829N/AMQPVRVRERIAGTLHQYVGLRAGAGWAQDSLRGTASLSGRRKFNKFFYDGELVLRYPVRAGVGSVIPYVLGGAGAVTLHRLDTSTSEDFTKFAGNFGAGLEYRYQRIGVRAEGRDLVYKFDRFGFDKTQHGIVWDAGVTVSF*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.