Scaffold Ga0133742_10177

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0133742_10177

Scaffold Ga0133742_10177

Overview

Basic Information
Taxon OID	3300009958 Open in IMG/M
Scaffold ID	Ga0133742_10177 Open in IMG/M
Source Dataset Name	Human saliva viral communities from oral cavities of healthy adults from Alicante,Spain - individual 8
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Autonomous University of Barcelona
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	3895
Total Scaffold Genes	9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	8 (88.89%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Oral Cavity → Saliva → Human Oral Cavity → Human Saliva Viral Communities From Oral Cavities Of Healthy Adults From Alicante,Spain

Source Dataset Sampling Location
Location Name	Alicante,Spain
Coordinates	Lat. (^o)	38.3852246	Long. (^o)	-0.5132249	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F049707	Metagenome	146	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0133742_101773	F049707	AGGAG	VVSEYRSPHNDGHDPYILIWEYGTEVQQAEFVERWAEYEPDTGWTVWYFRLDDGRVMTFRALEWDQRDDVNHLTTIYFTPKRKAN*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.