NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0133780_1030561

Scaffold Ga0133780_1030561


Overview

Basic Information
Taxon OID3300009967 Open in IMG/M
Scaffold IDGa0133780_1030561 Open in IMG/M
Source Dataset NameTermite gut microbial communities -laboratory nest Belgium. Combined Assembly of Gp0151224, Gp0151225, Gp0151226, Gp0151227
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterLuxembourg Institute of Science and Technology
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1436
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Insecta → Digestive System → Unclassified → Unclassified → Termite Gut → Multi-Omic Termite Study

Source Dataset Sampling Location
Location NameBelgium
CoordinatesLat. (o)50.814939Long. (o)4.383499Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F052010Metagenome143Y

Sequences

Protein IDFamilyRBSSequence
Ga0133780_10305611F052010N/AATGRATLAGQVEGDGPDERGYPGPPGWGLRVRLTTSPRKKTNCYETLQ*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.