Basic Information | |
---|---|
Taxon OID | 3300009967 Open in IMG/M |
Scaffold ID | Ga0133780_1068557 Open in IMG/M |
Source Dataset Name | Termite gut microbial communities -laboratory nest Belgium. Combined Assembly of Gp0151224, Gp0151225, Gp0151226, Gp0151227 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Luxembourg Institute of Science and Technology |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 927 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Host-Associated → Insecta → Digestive System → Unclassified → Unclassified → Termite Gut → Multi-Omic Termite Study |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Belgium | |||||||
Coordinates | Lat. (o) | 50.814939 | Long. (o) | 4.383499 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F000394 | Metagenome | 1186 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0133780_10685571 | F000394 | N/A | MEHPFLMFLGRTRRRGAVGGTPLDEWSARRGGLCLATRDAHN |
⦗Top⦘ |