NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0126380_10078227

Scaffold Ga0126380_10078227


Overview

Basic Information
Taxon OID3300010043 Open in IMG/M
Scaffold IDGa0126380_10078227 Open in IMG/M
Source Dataset NameTropical forest soil microbial communities from Panama - MetaG Plot_26
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1904
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (100.00%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil → Tropical Forest Soil Microbial Communities From Panama Analyzed To Predict Greenhouse Gas Emissions

Source Dataset Sampling Location
Location NamePanama
CoordinatesLat. (o)9.1086Long. (o)-79.8436Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000788Metagenome / Metatranscriptome891Y
F042506Metagenome / Metatranscriptome158Y
F068584Metagenome / Metatranscriptome124Y
F089331Metagenome / Metatranscriptome109N

Sequences

Protein IDFamilyRBSSequence
Ga0126380_100782272F042506GGAGMKPVQACSICGGAIVGFGNDAWPVNDDRCCDQCNAERVIPTLRFRERDAKRESSNGGGLQMIDLNDIEDDSFLAINATDLRWLYDLWVQLAHESRPLDRQAAAKRLADVLENAEFF*
Ga0126380_100782273F089331GGAGGMSELRMLSLAAAIAALVAYYSIQFYHLAVEPARAHATEHGR*
Ga0126380_100782274F068584GAGMSNILKPIDLADRAIRRAVFAVLDAAEHRANGKGSERLLWMQERDKHQVRVFIGGRP*
Ga0126380_100782275F000788GGAMKPRTVYEKAVQDFTETARQLARQNQHFRQASFAEFEMLMGFDDGVLKRYGLPKPMVERALLEAYQTVVL
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.