Scaffold Ga0133939_1030542

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0133939_1030542

Scaffold Ga0133939_1030542

Overview

Basic Information
Taxon OID	3300010051 Open in IMG/M
Scaffold ID	Ga0133939_1030542 Open in IMG/M
Source Dataset Name	Industrial wastewater microbial communities from reactors of effluent treatment plant in South Killingholme, Immingham, England. Combined Assembly of Gp0151195, Gp0151196
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Aalborg University
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	3861
Total Scaffold Genes	7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	5 (71.43%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Industrial Wastewater → Industrial Wastewater Microbial Communities From Reactors Of Effluent Treatment Plant In South Killingholme, Immingham, England

Source Dataset Sampling Location
Location Name	South Killingholme, Immingham, South Humberside, DN40 3DW, England
Coordinates	Lat. (^o)	53.633367	Long. (^o)	-0.251861	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F007832	Metagenome / Metatranscriptome	344	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0133939_10305424	F007832	AGGAG	VLLSADIFPGGGGIPADLFSIFCAVVLFALLYWAIDLIDRI*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.