Scaffold Ga0134290_1062894

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0134290_1062894

Scaffold Ga0134290_1062894

Overview

Basic Information
Taxon OID	3300010053 Open in IMG/M
Scaffold ID	Ga0134290_1062894 Open in IMG/M
Source Dataset Name	Insect gut microbial communities from Cryptocercus cockroaches from Viginia, USA
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Barcelona
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	531
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Insecta → Digestive System → Unclassified → Unclassified → Intestinal Tract → Insect Gut Microbial Communities From Cryptocercus Cockroaches From Viginia, Usa

Source Dataset Sampling Location
Location Name	Virginia, USA
Coordinates	Lat. (^o)	37.5	Long. (^o)	-79.0	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F052004	Metagenome	143	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0134290_10628941	F052004	N/A	MDVGGEDARWVELAQDRVQWRALVLSMLNLRDLLPES*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.