NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0136160_1003169

Scaffold Ga0136160_1003169


Overview

Basic Information
Taxon OID3300010225 Open in IMG/M
Scaffold IDGa0136160_1003169 Open in IMG/M
Source Dataset NameSitobion avenae (English Grain Aphid) hemolymph microbial communities from Shanxi Taiyuan, China - Region1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDNAVision
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2243
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis → Aphis craccivora(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Endosymbionts → Bacteria → Unclassified → Unclassified → Wheat → Sitobion Avenae (English Grain Aphid) Hemolymph Microbial Communities From Shanxi Taiyuan, China - Region1

Source Dataset Sampling Location
Location NameShanxi Taiyuan, China
CoordinatesLat. (o)37.87Long. (o)112.54Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F029983Metagenome186Y

Sequences

Protein IDFamilyRBSSequence
Ga0136160_10031691F029983GGTGGMSLCCTVGHKWVTVMDGVKFEFNDIISLYKKNDSERK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.