Basic Information | |
---|---|
Taxon OID | 3300010225 Open in IMG/M |
Scaffold ID | Ga0136160_1064360 Open in IMG/M |
Source Dataset Name | Sitobion avenae (English Grain Aphid) hemolymph microbial communities from Shanxi Taiyuan, China - Region1 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DNAVision |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 3709 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis → Aphis craccivora | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Host-Associated → Endosymbionts → Bacteria → Unclassified → Unclassified → Wheat → Sitobion Avenae (English Grain Aphid) Hemolymph Microbial Communities From Shanxi Taiyuan, China - Region1 |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Shanxi Taiyuan, China | |||||||
Coordinates | Lat. (o) | 37.87 | Long. (o) | 112.54 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F029983 | Metagenome | 186 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0136160_10643601 | F029983 | GGTGG | MLLCCSVGYKWVTIMDGVKFEFNDITSLGTKNASERRRFFSLDISYC |
⦗Top⦘ |