 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Taxon OID | 3300010229 Open in IMG/M |
| Scaffold ID | Ga0136218_1001107 Open in IMG/M |
| Source Dataset Name | Soil microbial communities from Bangor area, North Wales, UK, treated with sorgoleone, replicate 1 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Fidelity Systems Inc |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 4075 |
| Total Scaffold Genes | 7 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 5 (71.43%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Engineered → Lab Enrichment → Unclassified → Unclassified → Unclassified → Soil → Soil Microbial Communities From Bangor Area, North Wales, Uk Enriched With Cashew Seed Oil |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Bangor area, North Wales, UK | |||||||
| Coordinates | Lat. (o) | 53.24 | Long. (o) | -4.01 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F053534 | Metagenome | 141 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0136218_10011072 | F053534 | AGG | LNETLLWLLYLVSAAVAFLTVQKLSWRIVPSMLAGTVVTTVGWGMIFLLTAEDKRPAFWRLDLSLNASFALIFAGAGAAIAFAMKSSRSEH* |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |