Basic Information | |
---|---|
Taxon OID | 3300010262 Open in IMG/M |
Scaffold ID | Ga0129317_1004873 Open in IMG/M |
Source Dataset Name | Eastern black-and-white colobus group fecal microbial communities from Wisconsin, USA - Cm1105 metagenome |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 5140 |
Total Scaffold Genes | 6 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 5 (83.33%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Host-Associated → Mammals → Digestive System → Large Intestine → Fecal → Eastern Black-And-White Colobus Group Fecal → Animal Gut Microbial Communities From Fecal Samples From Wisconsin, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Wisconsin | |||||||
Coordinates | Lat. (o) | 43.07 | Long. (o) | -89.4 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F032286 | Metagenome / Metatranscriptome | 180 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0129317_10048731 | F032286 | N/A | MVKWVCQTVTSVRHRALVFNTRLFAGNAADDTLVTGGTFRFCRLMCLCVKRRNIMLNDKRRSLLNSALFRADNRTEQKTISLFSLALIFIFDFAALSECRSCPEDRSRRFVPVGTLTLSRSWRLLRWGTYPVRTVMQFSRFRSDCKTILAKNIALSRISKRS |
⦗Top⦘ |